DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and PUB4

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_179895.6 Gene:PUB4 / 816846 AraportID:AT2G23140 Length:829 Species:Arabidopsis thaliana


Alignment Length:460 Identity:101/460 - (21%)
Similarity:181/460 - (39%) Gaps:95/460 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YKNAALDSTEMRR---RREEVGIQLRKNKREQQLFKRRNVVLEPATSSTS----AGVESNTDNEQ 66
            :::.:.||.|:|.   .|..|....|.:....|..:..:.....|||:.|    ...::|.::|:
plant   403 FEDRSNDSRELRTDAPGRSSVSSTTRGSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEE 467

  Fly    67 QAADMHMADSSTGGQNEEAAGSGAQPSVINEEMIQMLFSGRENEQLEATQKFR----KLLSRDPN 127
            .|   |....|:....|..:|..|..:..........||.:..::....|.:|    :|.||..:
plant   468 SA---HATPYSSDASGEIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQFWRRPSERLGSRIVS 529

  Fly   128 PPIEEVIQ-----KGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTSQQTKVVIEAGAVPIFID 187
            .|..|..:     :..|.:.|..|::|:..| |.:|...|..:|........|:..:||:.:.::
plant   530 APSNETRRDLSEVETQVKKLVEELKSSSLDT-QRQATAELRLLAKHNMDNRIVIGNSGAIVLLVE 593

  Fly   188 LLSSPHDDVQEQAVWALGNIA-GDSPMCRDHLLGSGILEPLLHVLSNSDRITMIRNA--VWTLSN 249
            ||.|.....||.||.||.|:: .|:.  :..:..:|.:|||:|||.|........:|  :::||.
plant   594 LLYSTDSATQENAVTALLNLSINDNN--KKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSV 656

  Fly   250 LCRGK---------SPPADFAKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVID 305
            :...|         .|..|.  :.:|.|   |..|        |...|:..||....:|.. ::.
plant   657 IEENKIKIGQSGAIGPLVDL--LGNGTP---RGKK--------DAATALFNLSIHQENKAM-IVQ 707

  Fly   306 AGVCRRLVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLLHSTAETIKKESC 370
            :|..|.|:: |:.|...:...|:..:.|:.|       :..|.||:                   
plant   708 SGAVRYLID-LMDPAAGMVDKAVAVLANLAT-------IPEGRNAI------------------- 745

  Fly   371 WTISNIAAGNREQIQALINANIFPQLMVIMQTAEFKTRKEAAWAITN-ATSSGTHEQIHYLVQVG 434
                    |....|         |.|:.:::....:.::.||.|:.. :|:||..  .:.::|.|
plant   746 --------GQEGGI---------PLLVEVVELGSARGKENAAAALLQLSTNSGRF--CNMVLQEG 791

  Fly   435 CVPPM 439
            .|||:
plant   792 AVPPL 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 101/460 (22%)
IBB 3..116 CDD:280005 22/113 (19%)
ARM 131..252 CDD:237987 35/128 (27%)
armadillo repeat 133..165 CDD:293788 8/36 (22%)
armadillo repeat 173..209 CDD:293788 13/36 (36%)
armadillo repeat 215..250 CDD:293788 11/36 (31%)
ARM 264..378 CDD:237987 20/113 (18%)
armadillo repeat 267..292 CDD:293788 5/24 (21%)
armadillo repeat 300..336 CDD:293788 7/35 (20%)
armadillo repeat 342..376 CDD:293788 3/33 (9%)
ARM 356..461 CDD:237987 15/85 (18%)
armadillo repeat 384..421 CDD:293788 7/37 (19%)
armadillo repeat 427..461 CDD:293788 5/13 (38%)
Arm_3 473..517 CDD:292804
PUB4NP_179895.6 Ubox 236..299 CDD:128780
armadillo repeat 546..571 CDD:293788 8/25 (32%)
ARM 581..696 CDD:237987 34/129 (26%)
armadillo repeat 588..613 CDD:293788 9/24 (38%)
armadillo repeat 620..655 CDD:293788 9/34 (26%)
armadillo repeat 661..695 CDD:293788 9/46 (20%)
ARM 663..778 CDD:237987 29/172 (17%)
armadillo repeat 702..778 CDD:293788 19/120 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.