DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and SIL1

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_011541872.1 Gene:SIL1 / 64374 HGNCID:24624 Length:471 Species:Homo sapiens


Alignment Length:395 Identity:79/395 - (20%)
Similarity:151/395 - (38%) Gaps:81/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SHKQRYKNAALDSTEMRRRREEVGIQLRKNKREQQLFKRRNVVLEPA--------TSSTSAG--V 58
            || |..|..||.:.|....:|   .:.::.|.|::|......|..|.        ..:..||  |
Human    41 SH-QNLKEFALTNPEKSSTKE---TERKETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHV 101

  Fly    59 ESNTDNEQQAADMHMADSSTGGQNEEAAGSGAQPSVINEEMIQMLFSGRENEQLEATQKFR---- 119
            ..|....::.|.:...|........:....... :..::::...|...:|..::|::::.:    
Human   102 RLNLQTGEREAKLQYEDKFRNNLKGKRLDINTN-TYTSQDLKSALAKFKEGAEMESSKEDKARQA 165

  Fly   120 --KLLSRDPNPPIEEV----------------IQKGIVPQFVTFLRNSANATLQFEAAWTLTNIA 166
              |.|.|    ||||:                |...::.:|     ||::::|:.:.| .|.::.
Human   166 EVKRLFR----PIEELKKDFDELNVVIETDMQIMVRLINKF-----NSSSSSLEEKIA-ALFDLE 220

  Fly   167 SGTSQQTKV--VIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLH 229
            ....|....  ::..|.:.:.|:.|:|....|:|.|.:.||.....:|..:...:..|.|:.||.
Human   221 YYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLV 285

  Fly   230 VLSNSDRITMIRNAVWTLSNLCRGKSPPA--DFAKISHGLPILARLLKYTDADVLSDTCWAIGYL 292
            :|:....:|..:..::.|.:|.| ..|.|  .|.|:. ||.:|..|::....:||:  ...:..|
Human   286 ILATEQPLTAKKKVLFALCSLLR-HFPYAQRQFLKLG-GLQVLRTLVQEKGTEVLA--VRVVTLL 346

  Fly   293 SDGPNDKIQAVIDA--------------------------GVCRRLVELLLHPQQNVSTAALRAV 331
            .|...:|:.|..:|                          |.|.....||..|:.:.....|:.:
Human   347 YDLVTEKMFAEEEAELTQEMSPEKLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTL 411

  Fly   332 GNIVT 336
            |.::|
Human   412 GVLLT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 79/395 (20%)
IBB 3..116 CDD:280005 22/121 (18%)
ARM 131..252 CDD:237987 28/138 (20%)
armadillo repeat 133..165 CDD:293788 7/47 (15%)
armadillo repeat 173..209 CDD:293788 9/37 (24%)
armadillo repeat 215..250 CDD:293788 7/34 (21%)
ARM 264..378 CDD:237987 19/99 (19%)
armadillo repeat 267..292 CDD:293788 5/24 (21%)
armadillo repeat 300..336 CDD:293788 9/61 (15%)
armadillo repeat 342..376 CDD:293788
ARM 356..461 CDD:237987
armadillo repeat 384..421 CDD:293788
armadillo repeat 427..461 CDD:293788
Arm_3 473..517 CDD:292804
SIL1XP_011541872.1 Fes1 <203..232 CDD:285773 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.