DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and gudu

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster


Alignment Length:420 Identity:86/420 - (20%)
Similarity:160/420 - (38%) Gaps:61/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 EQLEATQKFRKLL--SRDPNPPIEEVIQKGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTSQQ 172
            |.|:.|:...:.|  ..|....:|::.:.||||.....|: |.:..:......|:...:|....|
  Fly   221 ESLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLK-SCHIDVVIPIMGTVRKCSSEPKFQ 284

  Fly   173 TKVVIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLL------HVL 231
            ..:..| |.:|..:..|||.:.:::.:...|:...|.|. ..||.:..:|.||||:      :|.
  Fly   285 LAITTE-GMIPDIVSHLSSENTELKMEGSTAIYKCAFDG-TTRDLVREAGGLEPLVTIIKDKNVR 347

  Fly   232 SNSDRITMIRNAVW-------------------------------TLSNLCRGKSPPADF----- 260
            .|...:.....|:|                               .|:|:....|....|     
  Fly   348 ENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAISECVRFQSNRE 412

  Fly   261 -AKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKIQAVIDAGVCRRLVELLLHPQQNVS 324
             .:.:.|||.:..||..:.|.:|.:....:...::.| |.::.:.|....|.:..||.:|...|.
  Fly   413 QLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDP-DSMRILEDLDAVRLIWSLLKNPTTRVQ 476

  Fly   325 TAALRAVGNIVTGDDQQTQVILG-YNALTCISHLLHSTAETIKKESCWTISNIAAGNREQIQALI 388
            ..|..|:...|...:...:::.. ..|:..:..||.|....:....|..|:.||. ::..:..|.
  Fly   477 AHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQ-DQTNLAILT 540

  Fly   389 NANIFPQLMVIMQTAEFKTRKEAAWAITNATSSGTHEQIHYLVQVGCVPPMCDFLTVVDSDIVQV 453
            :..:..:|..::||.:...|...|.|:......|.:.:  .|.::..|.|:..::| .|:.:|. 
  Fly   541 DLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTE--ELGRLRTVTPIVTYMT-SDNPLVH- 601

  Fly   454 ALNALENILKAGEKFQTRPNPYAITIEECG 483
                 .:...|.||....|. ..||:.:.|
  Fly   602 -----RSTAMALEKLSMDPQ-NCITMHQSG 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 86/420 (20%)
IBB 3..116 CDD:280005 2/5 (40%)
ARM 131..252 CDD:237987 32/157 (20%)
armadillo repeat 133..165 CDD:293788 7/31 (23%)
armadillo repeat 173..209 CDD:293788 7/35 (20%)
armadillo repeat 215..250 CDD:293788 12/71 (17%)
ARM 264..378 CDD:237987 25/114 (22%)
armadillo repeat 267..292 CDD:293788 6/24 (25%)
armadillo repeat 300..336 CDD:293788 8/35 (23%)
armadillo repeat 342..376 CDD:293788 6/34 (18%)
ARM 356..461 CDD:237987 21/104 (20%)
armadillo repeat 384..421 CDD:293788 7/36 (19%)
armadillo repeat 427..461 CDD:293788 6/33 (18%)
Arm_3 473..517 CDD:292804 3/11 (27%)
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788
Arm_3 214..557 CDD:330530 69/340 (20%)
armadillo repeat 245..275 CDD:293788 7/30 (23%)
armadillo repeat 286..318 CDD:293788 7/32 (22%)
armadillo repeat 328..362 CDD:293788 8/33 (24%)
armadillo repeat 411..447 CDD:293788 7/35 (20%)
armadillo repeat 453..484 CDD:293788 8/30 (27%)
armadillo repeat 494..526 CDD:293788 5/31 (16%)
ARM 614..652 CDD:214547 4/13 (31%)
armadillo repeat 619..652 CDD:293788 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.