DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and Hspbp1

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_038955262.1 Gene:Hspbp1 / 246146 RGDID:628677 Length:361 Species:Rattus norvegicus


Alignment Length:503 Identity:95/503 - (18%)
Similarity:167/503 - (33%) Gaps:180/503 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRNVVLEPATSSTSAGVESNTDNEQQAADMHMADSSTGGQNEEAAGSGAQPSVINEEMIQMLFSG 106
            |..:.|.||:...|:|               .:.||.||     :|:...|..: :.::||..:.
  Rat    10 RLPLALPPASQGCSSG---------------SSGSSAGG-----SGNPRLPRNL-QGLLQMAITA 53

  Fly   107 RENEQLEATQKFRKLLSRDPNPPIEEVIQKGIVPQFVTFLRNSANATL--QFEAAWTLTNIASGT 169
            .               |.:|:||.|.:.:     :...:|:.:.:|..  |.|....:.|.....
  Rat    54 G---------------SEEPDPPPEPMSE-----ERRQWLQEAMSAAFRGQREEVEQMKNCLRVL 98

  Fly   170 SQQTKVVIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNS 234
            ||.|...                               ||::.:..|.....|.||         
  Rat    99 SQATPPT-------------------------------AGEAELATDQQEREGALE--------- 123

  Fly   235 DRITMIRNAVWTLSNLCRGKSPPADFAKISHGLPILARLLKYTDADVLSDTCWAIG-YLSDGPND 298
                       .|::||......|||.::| |:.:|                  :| ||..|.  
  Rat   124 -----------LLADLCENMDNAADFCQLS-GMHLL------------------VGRYLEAGA-- 156

  Fly   299 KIQAVIDAGVCRRLVELLLHPQQNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLL-HSTA 362
                   ||:..|..:|:....|||  ||::             :.:||..||..:..|| ..:.
  Rat   157 -------AGLRWRAAQLIGTCSQNV--AAIQ-------------EQVLGLGALRKLLRLLDRDSC 199

  Fly   363 ETIKKESCWTISNIAAGNREQIQALINANIFPQLMVIMQTAEFKTRKEAAWAITN---------A 418
            :|::.::.:.||.:.......:...:..:.|..||..||....|.:.::|:.:.|         |
  Rat   200 DTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKA 264

  Fly   419 TSSGTHEQIHYLVQVGCVPPMCDFLTVVDSDIVQVALNALENILKAGEKFQTRPNPYAITIEECG 483
            ...||      |..:|.|..:...:....|...:..|.||.:::          ..:...:.||.
  Rat   265 LPPGT------LCSMGMVQQLVALVRTEHSPFHEHVLGALCSLV----------TDFPQGVRECR 313

  Fly   484 ----GLDKI-----EYLQAHENRDIYHKSFYIIEQY----FGNEEEDS 518
                ||:::     :.||.||.   |.:.....|:.    |.:..:||
  Rat   314 EPELGLEELLRHRCQLLQQHEE---YQEELEFCEKLLQTCFSSPTDDS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 95/503 (19%)
IBB 3..116 CDD:280005 14/73 (19%)
ARM 131..252 CDD:237987 17/122 (14%)
armadillo repeat 133..165 CDD:293788 4/33 (12%)
armadillo repeat 173..209 CDD:293788 1/35 (3%)
armadillo repeat 215..250 CDD:293788 5/34 (15%)
ARM 264..378 CDD:237987 25/115 (22%)
armadillo repeat 267..292 CDD:293788 2/25 (8%)
armadillo repeat 300..336 CDD:293788 9/35 (26%)
armadillo repeat 342..376 CDD:293788 9/34 (26%)
ARM 356..461 CDD:237987 23/114 (20%)
armadillo repeat 384..421 CDD:293788 9/45 (20%)
armadillo repeat 427..461 CDD:293788 7/33 (21%)
Arm_3 473..517 CDD:292804 11/56 (20%)
Hspbp1XP_038955262.1 Fes1 43..137 CDD:400776 24/165 (15%)
armadillo repeat 135..172 CDD:293788 14/64 (22%)
armadillo repeat 178..213 CDD:293788 9/47 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.