DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kap-alpha1 and HSPBP1

DIOPT Version :9

Sequence 1:NP_524167.1 Gene:Kap-alpha1 / 40160 FlyBaseID:FBgn0024889 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_005258757.1 Gene:HSPBP1 / 23640 HGNCID:24989 Length:431 Species:Homo sapiens


Alignment Length:397 Identity:70/397 - (17%)
Similarity:130/397 - (32%) Gaps:107/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RRNVVLEPATSSTSAGVESNTDNEQQAADMHMADSSTGGQNEEAAGSG-AQPSVINEEMIQMLFS 105
            |..:.|.||:...|:|                    .||....|.||| ::|....:.::||..:
Human    10 RLPLALPPASQGCSSG--------------------GGGGGSSAGGSGNSRPPRNLQGLLQMAIT 54

  Fly   106 GRENEQLEATQKFRKLLSRDPNPPIEEVIQKGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTS 170
            ..               |.:|:||.|.:.::                    ...|....:::...
Human    55 AG---------------SEEPDPPPEPMSEE--------------------RRQWLQEAMSAAFR 84

  Fly   171 QQTKVVIEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGDSPMCRDHLLGSGILEPLLHVLSNSD 235
            .|.:   |...:...:.:||.|           :...||::....|.....|.||          
Human    85 GQRE---EVEQMKSCLRVLSQP-----------MPPTAGEAEQAADQQEREGALE---------- 125

  Fly   236 RITMIRNAVWTLSNLCRGKSPPADFAKISHGLPILARLLKYTDADVLSDTCWAIGYLSDGPNDKI 300
                      .|::||......|||.::|....::.|.|:...|.:.......||..|.......
Human   126 ----------LLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQ 180

  Fly   301 QAVIDAGVCRRLVELLLHPQ-QNVSTAALRAVGNIVTGDDQQTQVILGYNALTCISHLLHSTAET 364
            :.|:..|..|:|:.||.... ..|...||.|:..:|...:......|..:..:.:...:....:.
Human   181 EQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQK 245

  Fly   365 IKKESCWTISNIAAGNREQIQALINANIFPQLMVIMQTAEFKTRKEA----------------AW 413
            :|.:|.:.:.|:..|:.|....|.:..:..||:.:::|......:..                ||
Human   246 LKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCRVCASVGSRNWAW 310

  Fly   414 AITNATS 420
            ..::||:
Human   311 RSSSATA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kap-alpha1NP_524167.1 SRP1 1..543 CDD:227396 70/397 (18%)
IBB 3..116 CDD:280005 15/74 (20%)
ARM 131..252 CDD:237987 15/120 (13%)
armadillo repeat 133..165 CDD:293788 1/31 (3%)
armadillo repeat 173..209 CDD:293788 4/35 (11%)
armadillo repeat 215..250 CDD:293788 5/34 (15%)
ARM 264..378 CDD:237987 22/114 (19%)
armadillo repeat 267..292 CDD:293788 5/24 (21%)
armadillo repeat 300..336 CDD:293788 10/36 (28%)
armadillo repeat 342..376 CDD:293788 3/33 (9%)
ARM 356..461 CDD:237987 13/81 (16%)
armadillo repeat 384..421 CDD:293788 8/53 (15%)
armadillo repeat 427..461 CDD:293788
Arm_3 473..517 CDD:292804
HSPBP1XP_005258757.1 Fes1 45..139 CDD:312204 22/162 (14%)
armadillo repeat 88..130 CDD:293788 11/75 (15%)
armadillo repeat 137..174 CDD:293788 9/36 (25%)
armadillo repeat 180..215 CDD:293788 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.