DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-F and Pigf

DIOPT Version :8

Sequence 1:NP_649134.3 Gene:PIG-F / 40139 FlyBaseID:FBgn0036893 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006225734.1 Gene:Pigf / 681086 RGDID:1584658 Length:244 Species:Rattus norvegicus

Alignment Length:151 Identity:39/152 (26%)
Similarity:66/152 (43%) Gaps:34/152 (22%)


  Fly    97 LQFLCTLLYAFICIIL-GAPVLGNYEQTFVLALLMTLLTVSPTVFLLGGGGALQVCFCEKPDF-- 158
            |.||.:..:..|..:| |||::....:||:.|::::..|..|.:.|||            |:.  
  Rat   110 LYFLASCFFLHIIFVLYGAPLMELVLETFLFAVVLSTFTTVPCLCLLG------------PNLKA 162

  Fly   159 ---------VTKCEDTALNLFKYNALGGILGAWAGSVVAPLDWGRDWQAYPIPNVIGALLGSALG 214
                     ||...:.:|.:   ..:...:|||.|:...||||.|.||.:||...:||..|...|
  Rat   163 WLRVFSRNGVTSVWENSLQI---TTVSSFIGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAG 224

  Fly   215 NIYACTHVLYATARVYMTKKR 235
                   ::.:...:|..:|:
  Rat   225 -------LVISPLWIYWNRKQ 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PIG-FNP_649134.3 PIG-F <73..214 CDD:284183 36/129 (28%)
PigfXP_006225734.1 PIG-F 46..229 CDD:284183 37/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C254719692
eggNOG 1 0.900 E1_KOG3144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1182539at2759
OrthoFinder 1 1.000 FOG0005118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130537
Panther 1 1.100 LDO PTHR43157
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.