DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and LON2

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_568675.1 Gene:LON2 AraportID:AT5G47040 Length:888 Species:Arabidopsis thaliana

Alignment Length:980 Identity:324/981 (33%)
Similarity:495/981 (50%) Gaps:181/981 (18%)


  Fly    84 TVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKV--KLNQPYVGVFLKKTDGEEE 146
            ||.:|.   .:.:|..|...|.|..:..:..::...:.|:.:::  |..:..:|:...:.|.|..
plant     4 TVELPS---RLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRDDAEGS 65

  Fly   147 LITNLNDVYNLGTFAQIQELQDLGDK-LRMVVVAHRRIRITGQVVEDVPPPKPVKMTTLHYPLFN 210
                     ::||........|.|:: |:.:|                                 
plant    66 ---------SIGTMINPGAGSDSGERSLKFLV--------------------------------- 88

  Fly   211 IKLQIPAEDQSTDQADAAPIKSRSDPARKPRGRIPRSRTGKSRESAAAEELIQNQTLEPPLKSGK 275
                      .|..|..:..|.:.|.....||             .||..|..::.:|.|  ||:
plant    89 ----------GTTDAQKSDAKDQQDLQWHTRG-------------VAARALHLSRGVEKP--SGR 128

  Fly   276 VESSSLPKPPTEEKIVEPETGAKENVNQSAP----SAQPVLIVEVENVKQPIYKQTEEVKALTQE 336
            |           ..:|..|..::.||.:...    |...:..:|:...:....||..:..||:::
plant   129 V-----------TYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVKQDPDFVALSRQ 182

  Fly   337 IIKTLRDIITMNPLYRESLQQMLHQNQRVVDN--------PIY-LCDLGASLSAGEPAELQKILE 392
            ...|..::::           :|.|.|:....        ||: |.|:..:.......|...:|:
plant   183 FKTTAMELVS-----------VLEQKQKTGGRTKVLLETVPIHKLADIFVASFEMSFEEQLSMLD 236

  Fly   393 ETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDA 457
            ..|:..||..|..|:.:.|:..|:.:||.::||.::.:..::|:|::|::.||:|||...||:|.
plant   237 SVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEYLLRQQMRAIKEELGDNDDDEDD 301

  Fly   458 IGEKYREKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTEN-LCL 521
            :....| |::...:|..|......||.:|..::.....:|.:|.||:.|..|||...|.|: |.|
plant   302 VAALER-KMQAAGMPSNIWKHAQRELRRLKKMQPQQPGYNSSRVYLELLADLPWDKASEEHELDL 365

  Fly   522 EKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYF 586
            :.|.|.|:.||||:..:|:||:|::||..||...:|.:|||.|||||||||:|.|||.||.|::.
plant   366 KAAKERLDSDHYGLAKVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIAAALGRKFV 430

  Fly   587 RFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLEL 651
            |.|:||:.|.|:|:||||||:|:|||:||..||:..:.||::|:||:||.|...:|||:|||||:
plant   431 RLSLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEV 495

  Fly   652 LDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLM 716
            ||||||.:|.||||:||.|||:|:|:.|||.:..||.||.|||||||:.||..|||:.||.::|:
plant   496 LDPEQNKSFNDHYLNVPYDLSKVVFVATANRVQPIPPPLLDRMELIELPGYTQEEKLKIAMRHLI 560

  Fly   717 PQAMKDCGLTDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEGEHFPVNAD 781
            |:.:...||:.:.:.|.|..:..:|:.|.||:|||:|::::..:.|..|..|.:.| :..|::.|
plant   561 PRVLDQHGLSSEFLKIPEAMVKNIIQRYTREAGVRSLERNLAALARAAAVMVAEHE-QSLPLSKD 624

  Fly   782 --NLT------------------------------TF----------------LGKQIF----SS 794
              .||                              ||                ||...|    ::
plant   625 VQKLTSPLLNGRMAEGGEVEMEVIPMGVNDHEIGGTFQSPSALVVDETMLEKILGPPRFDDSEAA 689

  Fly   795 DRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQGAKTDPNTVAGSLHITGNLGDVMKESAQI 859
            ||:   ...||.:||.||..||...::|.:..           ...|.:|:||.||||:|||||:
plant   690 DRV---ASAGVSVGLVWTTFGGEVQFVEATSM-----------VGKGEMHLTGQLGDVIKESAQL 740

  Fly   860 ALTVAR----NFLYSLEPNNLFLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDI 920
            |||..|    :|..:|..:...|:...||:|.|.||.||||||||:|::||||||.:.|.||.|.
plant   741 ALTWVRARASDFKLALAGDMNVLDGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSQKRVRADT 805

  Fly   921 AMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDV 985
            |||||::|:|.||||||||:|.:||.|.|:..:|||..|.||..|:|..:...|||..|...|||
plant   806 AMTGEMTLRGLVLPVGGIKDKILAAHRYGIKRVILPQRNSKDLVEVPAAVLSSLEVILAKRMEDV 870

  Fly   986 YKIAF 990
            .:.||
plant   871 LENAF 875

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 9/57 (16%)
lon 95..990 CDD:273258 320/968 (33%)
P-loop_NTPase 530..>581 CDD:304359 30/51 (59%)
AAA 560..702 CDD:278434 89/142 (63%)
ChlI 778..991 CDD:304493 101/270 (37%)
LON2NP_568675.1 LON 10..>67 CDD:197740 9/66 (14%)
lon 12..875 CDD:273258 320/968 (33%)
AAA 404..546 CDD:278434 89/142 (63%)
ChlI 668..877 CDD:304493 96/223 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126991
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.