DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and LON4

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_566259.1 Gene:LON4 AraportID:AT3G05790 Length:942 Species:Arabidopsis thaliana

Alignment Length:1066 Identity:429/1067 (40%)
Similarity:592/1067 (55%) Gaps:247/1067 (23%)


  Fly    23 RNRPIQSSLMQYCRDRSLRLQRLHGANLMVQRFYSRKRDDSNGDIIMGPDLMSDQDTHLPATVAV 87
            |:.|:::.|.:       :|..|.|.|   :..|...|...:.|:        |.||....|.. 
plant    22 RSTPVKNLLFK-------QLTLLTGWN---RSSYELGRRSFSSDL--------DSDTKSSTTTV- 67

  Fly    88 PDVWPH------VPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKTDGE-- 144
             ...||      |..|.:...||.|.|...:.|.:|.::..|:...:...||.|.||.|.|..  
plant    68 -SAKPHLDDCLTVIALPLPHKPLIPGFYMPIYVKDPKVLAALQESRRQQAPYAGAFLLKDDASSD 131

  Fly   145 -------EELITNL------NDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQVVEDVPPP 196
                   |.::..|      |.::.:||.|||..:|  |:  :::::.||::|||..|.|...| 
plant   132 SSSSSETENILEKLKGKELINRIHEVGTLAQISSIQ--GE--QVILIGHRQLRITEMVSESEDP- 191

  Fly   197 KPVKMTTLHYPLFNIKLQIPAEDQSTDQADAAPIKSRSDPARKPRGRIPRSRTGKSRESAAAEEL 261
                                                                             
plant   192 ----------------------------------------------------------------- 191

  Fly   262 IQNQTLEPPLKSGKVESSSLPKPPTEEKIVEPETGAKENVNQSAPSAQPVLIVEVENVK-QPIYK 325
                                                              |.|:|:::| :|..|
plant   192 --------------------------------------------------LTVKVDHLKDKPYDK 206

  Fly   326 QTEEVKALTQEIIKTLRDIITMNPLYRESLQ--------QMLHQNQRVVD-NPIYLCDLGASLSA 381
            ..:.:||...:::.||||::....|:|:.::        .:.|..:.:.: |...|.|.||.:|.
plant   207 DDDVIKATYFQVMSTLRDVLKTTSLWRDHVRTYTQACSLHIWHCLRHIGEFNYPKLADFGAGISG 271

  Fly   382 GEPAELQKILEETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKK 446
            ....:.|.:|||.|:.:||:|.|.|:|||:|::::|:.|.:.||||.....|:.||:||:..|||
plant   272 ANKHQNQGVLEELDVHKRLELTLELVKKEVEINKIQESIAKAVEEKFSGDRRRIILKEQINAIKK 336

  Fly   447 ELGIEKDDKDAIGEKYR---EKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTS 508
            |||.|.|.|.|:.||:|   :.:||| :|..::.||:|||.||..||:.||||:||.|||||||.
plant   337 ELGGETDSKSALSEKFRGRIDPIKDK-IPGHVLKVIEEELKKLQLLETSSSEFDVTCNYLDWLTV 400

  Fly   509 LPWGVISTENLCLEKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSI 573
            ||||..|.||..:.:|.:.|::||||:.|:|:||||||||..|:|::||||:|..||.|||||||
plant   401 LPWGNFSDENFNVLRAEKILDEDHYGLSDVKERILEFIAVGGLRGTSQGKIICLSGPTGVGKTSI 465

  Fly   574 AKSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIG- 637
            .:||||||:|::|||||||::||||||||||||:||||||::||||....|||||||||:||:| 
plant   466 GRSIARALDRKFFRFSVGGLSDVAEIKGHRRTYIGAMPGKMVQCLKNVGTENPLVLIDEIDKLGV 530

  Fly   638 KGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGY 702
            :|:.|||:||:||||||||||||||||||||:|||:|||:|||||.||||.||.||||:|.:|||
plant   531 RGHHGDPASAMLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVTDTIPGPLLDRMEVITLSGY 595

  Fly   703 VAEEKIAIARQYLMPQAMKDCGLTDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFR 767
            :.:||:.|||.||...|.:|||:..:.:::|:.|...||..||||:|||||||.|||:.||:|.:
plant   596 ITDEKMHIARDYLEKTARRDCGIKPEQVDVSDAAFLSLIEHYCREAGVRNLQKQIEKIFRKIALK 660

  Fly   768 VVKK-----------------------------------EG------------------------ 773
            :|:|                                   ||                        
plant   661 LVRKAASTEVPRISDDVTTDTEETKSLAKTDLESPETSAEGSTVLTDELATGDPTESTTEQSGEV 725

  Fly   774 ----EHFPVNADNLTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQGAKT 834
                |.:.::..||:.::||.:|..:::|..||||||||||||:||||:|||||:  .:.:|.. 
plant   726 AETVEKYMIDESNLSDYVGKPVFQEEKIYEQTPVGVVMGLAWTSMGGSTLYIETT--FVEEGEG- 787

  Fly   835 DPNTVAGSLHITGNLGDVMKESAQIALTVARNFLYSLEPNNLFLEQEHIHLHVPEGATPKDGPSA 899
                 .|.|||||.|||||||||:||.||||..:...||.|.......:|||||.||||||||||
plant   788 -----KGGLHITGRLGDVMKESAEIAHTVARRIMLEKEPENKLFANSKLHLHVPAGATPKDGPSA 847

  Fly   900 GITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFE 964
            |.|:||:|:|||..||||:|:||||||:|.|::|.:||:||||||||||.|..:|.|..|::||:
plant   848 GCTMITSLLSLALKKPVRKDLAMTGEVTLTGRILAIGGVKEKTIAARRSQVKVIIFPEANRRDFD 912

  Fly   965 ELPTYITDGLEVHFATTYEDVYKIAF 990
            ||...:.:||||||...||.::::||
plant   913 ELARNVKEGLEVHFVDEYEQIFELAF 938

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 18/70 (26%)
lon 95..990 CDD:273258 411/987 (42%)
P-loop_NTPase 530..>581 CDD:304359 35/51 (69%)
AAA 560..702 CDD:278434 108/143 (76%)
ChlI 778..991 CDD:304493 119/214 (56%)
LON4NP_566259.1 LON 78..>125 CDD:197740 14/47 (30%)
lon 81..938 CDD:273258 411/986 (42%)
P-loop_NTPase 408..>475 CDD:304359 40/67 (60%)
AAA 452..595 CDD:278434 108/143 (76%)
ChlI 734..938 CDD:304493 118/212 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 748 1.000 Inparanoid score I108
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124745
orthoMCL 1 0.900 OOG5_126991
Panther 1 1.100 LDO PTHR43718
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.