DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and LON3

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_566258.1 Gene:LON3 AraportID:AT3G05780 Length:924 Species:Arabidopsis thaliana

Alignment Length:1060 Identity:401/1061 (38%)
Similarity:566/1061 (53%) Gaps:284/1061 (27%)


  Fly    24 NRPIQSSLMQYCRDRSLRL-QRLHGANLMVQRFYSRK---RDDSNG-DIIMGPDLMS---DQDTH 80
            :.|:||.|:       .|. .:|.|.|...:....|:   .|.|:| |::....::|   :.|..
plant    52 SNPVQSLLL-------FRAPTQLTGWNRSSRDLLGRRVSFSDRSDGVDLLSSSPILSTNPNLDDS 109

  Fly    81 LPATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKK----T 141
            | ..:|:|  .||        .||.|.|...:.|.:|.::..|:...:...||||.||.|    |
plant   110 L-TVIALP--LPH--------KPLIPGFYMPIHVKDPKVLAALQESTRQQSPYVGAFLLKDCAST 163

  Fly   142 DG------EEELITN---------------LNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRI 185
            |.      |:.::..               ||.::.:||.|||..:|  |:  ::::|..||:.|
plant   164 DSSSRSETEDNVVEKFKVKGKPKKKRRKELLNRIHQVGTLAQISSIQ--GE--QVILVGRRRLII 224

  Fly   186 TGQVVEDVPPPKPVKMTTLHYPLFNIKLQIPAEDQSTDQADAAPIKSRSDPARKPRGRIPRSRTG 250
            ...|.||                                                          
plant   225 EEMVSED---------------------------------------------------------- 231

  Fly   251 KSRESAAAEELIQNQTLEPPLKSGKVESSSLPKPPTEEKIVEPETGAKENVNQSAPSAQPVLIVE 315
                                                                        .|.|.
plant   232 ------------------------------------------------------------PLTVR 236

  Fly   316 VENVK-QPIYKQTEEVKALTQEIIKTLRDIITMNPLYR-ESLQQMLHQNQRVVDNPIYLCDLGAS 378
            |:::| :|..|....:||...|:|.|||:::..|.|:| :.:....:|         :|.|.||.
plant   237 VDHLKDKPYDKDNAVIKASYVEVISTLREVLKTNSLWRDQDIGDFSYQ---------HLADFGAG 292

  Fly   379 LSAGEPAELQKILEETDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKV 443
            :|.....:.|.:|.|.|:.:||:|.|.|:||::|:::::                          
plant   293 ISGANKHKNQGVLTELDVHKRLELTLELVKKQVEINKIK-------------------------- 331

  Fly   444 IKKELGIEKDDKDAIGEKYREKL---KDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDW 505
                   |.||..::..|.|.::   :|| :|:.::.|::||.|||..||.:.|:|::|.|||.|
plant   332 -------ETDDGSSLSAKIRVRIDTKRDK-IPKHVIKVMEEEFTKLEMLEENYSDFDLTYNYLHW 388

  Fly   506 LTSLPWGVISTENLCLEKATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGK 570
            ||.||||..|.||..:.:|.:.|::||||:.|:|:||||||||..|:|::||||:|..|||||||
plant   389 LTVLPWGNFSYENFDVLRAKKILDEDHYGLSDVKERILEFIAVGRLRGTSQGKIICLSGPPGVGK 453

  Fly   571 TSIAKSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDK 635
            |||.:||||||:|::|||||||::||||||||.:|||||||||::||||.....|||:|.||:||
plant   454 TSIGRSIARALDRKFFRFSVGGLSDVAEIKGHCQTYVGAMPGKMVQCLKSVGTANPLILFDEIDK 518

  Fly   636 IGKGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMS 700
            :|:.:.|||:|||||::||||||.||||:|:|.:|||:|||:||||||:.||.||.||||:|::|
plant   519 LGRCHTGDPASALLEVMDPEQNAKFLDHFLNVTIDLSKVLFVCTANVIEMIPGPLLDRMEVIDLS 583

  Fly   701 GYVAEEKIAIARQYLMPQAMKDCGLTDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVA 765
            |||.:||:.|||.||:.:..:|||:..:|:::|:.||..||.:||||:|||||||.|||:.||||
plant   584 GYVTDEKMHIARDYLVKKTCRDCGIKPEHVDLSDAALLSLIENYCREAGVRNLQKQIEKIYRKVA 648

  Fly   766 FRVVKKEGEHFPVN--------------------AD----------------------------- 781
            ..:|::....|.|.                    ||                             
plant   649 LELVRQGAVSFDVTDTKDTKSLAKTDSEVKRMKVADIMKILESATGDSTESKTKQSGLVAKTFEK 713

  Fly   782 ------NLTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMGGSSLYIETSRRHIRQGAKTDPNTVA 840
                  ||..::||.:|..:::|..||||||||||||:||||:|||||:  .:.:|..      .
plant   714 VMIDESNLADYVGKPVFQEEKIYEQTPVGVVMGLAWTSMGGSTLYIETT--FVEEGLG------K 770

  Fly   841 GSLHITGNLGDVMKESAQIALTVARNFLYSLEPNNLFLEQEHIHLHVPEGATPKDGPSAGITIIT 905
            |.|||||.||||||||||||.||||..::..||.|||.....:|||||||||||||||||.|:||
plant   771 GGLHITGQLGDVMKESAQIAHTVARRIMFEKEPENLFFANSKLHLHVPEGATPKDGPSAGCTMIT 835

  Fly   906 ALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYI 970
            :.:|||..|.||:|:||||||:|.|::||:||:||||||||||.:..:|.|..|::|||||...:
plant   836 SFLSLAMKKLVRKDLAMTGEVTLTGRILPIGGVKEKTIAARRSQIKTIIFPEANRRDFEELAENM 900

  Fly   971 TDGLEVHFATTYEDVYKIAF 990
            .:||:|||...||.::.:||
plant   901 KEGLDVHFVDEYEKIFDLAF 920

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 18/65 (28%)
lon 95..990 CDD:273258 380/980 (39%)
P-loop_NTPase 530..>581 CDD:304359 36/51 (71%)
AAA 560..702 CDD:278434 98/142 (69%)
ChlI 778..991 CDD:304493 124/269 (46%)
LON3NP_566258.1 LON 111..>164 CDD:197740 19/63 (30%)
lon 114..920 CDD:273258 384/989 (39%)
P-loop_NTPase 399..>466 CDD:304359 41/67 (61%)
AAA 443..585 CDD:278434 98/142 (69%)
ChlI 716..920 CDD:304493 120/212 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 748 1.000 Inparanoid score I108
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124745
orthoMCL 1 0.900 OOG5_126991
Panther 1 1.100 O PTHR43718
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.