DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and Lonp1

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_083058.2 Gene:Lonp1 MGIID:1921392 Length:949 Species:Mus musculus

Alignment Length:914 Identity:570/915 (62%)
Similarity:690/915 (75%) Gaps:84/915 (9%)


  Fly    83 ATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKTD-GEEE 146
            |.:.||||:||:||:|:.:||:||||:|||||.|..:::||||||:|.|||||||||:.| .|.:
Mouse   101 APMTVPDVFPHLPLIAITRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNNESD 165

  Fly   147 LITNLNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQVVEDVPPPKPVKMTTLHYPLFNI 211
            ::.:|:::|:.||||||.|:|||||||||:|..||||.|:.|                       
Mouse   166 VVESLDEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHISRQ----------------------- 207

  Fly   212 KLQIPAEDQSTDQADAAPIKSRSDPARKPRGRIPRSRTGKSRESAAAEELIQNQTLEPPLKSGKV 276
             |::                       :|.|..|.:...|||..               ||.||.
Mouse   208 -LEV-----------------------EPEGLEPEAEKQKSRRK---------------LKRGKK 233

  Fly   277 ESSSLPKPPTEEKIVEPETGAK---ENVNQSA-PSAQPVLIVEVENVKQPIYKQTEEVKALTQEI 337
            |             ||.|.|.|   |.|.::| .:::.||:||||||....::.||||||||.||
Mouse   234 E-------------VEDELGPKPQLEMVTEAATDTSKEVLMVEVENVAHEDFQVTEEVKALTAEI 285

  Fly   338 IKTLRDIITMNPLYRESLQQMLHQNQRVVDNPIYLCDLGASLSAGEPAELQKILEETDIPERLQL 402
            :||:||||.:|||||||:.||:...||||||||||.|:||:|:..|..|||.:||||:|.:||..
Mouse   286 VKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNILKRLYK 350

  Fly   403 ALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDAIGEKYREKLK 467
            ||:|||||.|||:|||::|||||||:||.||||:||||||:||||||:||||||||.||:||:|:
Mouse   351 ALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLR 415

  Fly   468 DKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLEKATETLNDDH 532
            :.|||:.:|.|:||||:||..|::|||||||||||||||||:|||..|.|||.|.:|...|.:||
Mouse   416 ELVVPKHVMDVVDEELSKLALLDNHSSEFNVTRNYLDWLTSIPWGRQSDENLDLARAQAVLEEDH 480

  Fly   533 YGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFRFSVGGMTDVA 597
            |||||:|||:|||||||.|:||||||||||||||||||||||:||||||.|||||||||||||||
Mouse   481 YGMEDVKKRVLEFIAVSQLRGSTQGKILCFHGPPGVGKTSIARSIARALGREYFRFSVGGMTDVA 545

  Fly   598 EIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELLDPEQNANFLD 662
            ||||||||||||||||:||||||||.||||||||||||||:||||||||||||||||||||||||
Mouse   546 EIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSALLELLDPEQNANFLD 610

  Fly   663 HYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMPQAMKDCGLTD 727
            ||||||||||:||||||||||||||||||||||:|.:|||||:||:|||.:||:|||...|||.:
Mouse   611 HYLDVPVDLSKVLFICTANVIDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARTLCGLDE 675

  Fly   728 KHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEGEHFPVNADNLTTFLGKQIF 792
            ....:|...|.:||:.||||||||||||.:|||:||.|:::|..|.:...|..:||..|:||.:|
Mouse   676 SKAQLSAAVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYKIVSGEAQTVQVTPENLQDFVGKPVF 740

  Fly   793 SSDRMYATTPVGVVMGLAWTAMGGSSLYIETS-RRHIRQGAKTDPNTVAGSLHITGNLGDVMKES 856
            :.:|||..||.||||||||||||||:|::||| ||....|:|.|.:   |||.:||.||||||||
Mouse   741 TVERMYEVTPPGVVMGLAWTAMGGSTLFVETSLRRPQPSGSKEDKD---GSLEVTGQLGDVMKES 802

  Fly   857 AQIALTVARNFLYSLEPNNLFLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIA 921
            |:||.|.||.||...:|.|.||...|||||||||||||||||||.||:|||:|||.|:||.|::|
Mouse   803 ARIAYTYARAFLMEQDPENDFLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLALGQPVLQNLA 867

  Fly   922 MTGEVSLKGKVLPVGGIKEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVY 986
            |||||||.||||||||||||||||:|:||.|:|||.:|:||:.:|..:||:||||||...|.|::
Mouse   868 MTGEVSLTGKVLPVGGIKEKTIAAKRAGVTCIILPAENRKDYSDLAPFITEGLEVHFVEHYRDIF 932

  Fly   987 KIAF 990
            .|||
Mouse   933 PIAF 936

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 34/56 (61%)
lon 95..990 CDD:273258 562/901 (62%)
P-loop_NTPase 530..>581 CDD:304359 45/51 (88%)
AAA 560..702 CDD:278434 133/142 (94%)
ChlI 778..991 CDD:304493 139/215 (65%)
Lonp1NP_083058.2 LON 111..188 CDD:197740 45/77 (58%)
lon 113..936 CDD:273258 562/901 (62%)
P-loop_NTPase 478..>529 CDD:304359 45/51 (88%)
AAA 508..650 CDD:278434 133/142 (94%)
ChlI 725..938 CDD:304493 139/216 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C272195334
eggNOG 1 0.900 E1_COG0466
Hieranoid 1 1.000
Homologene 1 1.000 H3521
Inparanoid 1 1.050 1081 1.000 Inparanoid score I244
Isobase 1 0.950 0 Normalized mean entropy S666
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003703
OrthoInspector 1 1.000 T1083219
orthoMCL 1 0.900 OOG5_126991
Panther 1 1.100 LDO PTHR43718
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R662
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.