DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and lonp2

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_001008573.1 Gene:lonp2 ZFINID:ZDB-GENE-041212-1 Length:840 Species:Danio rerio

Alignment Length:978 Identity:329/979 (34%)
Similarity:482/979 (49%) Gaps:196/979 (20%)


  Fly    85 VAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKV----KLNQPYVGVFLKKTDGEE 145
            :.:|.   .:|||......|.|.....|.|.....|.|::.::    .|....:||.....|.|.
Zfish     7 IQIPS---RLPLLCTHDGVLLPGSTMRVSVDTARNMQLVKSRLLKGTSLKSTIIGVIPNTRDPEH 68

  Fly   146 ELITNLNDVYNLGTFAQIQELQDLGDKLRMVVVAHRRIRITGQVVEDVPPPKPVKMTTLHYPLFN 210
            : ...|..::::||                   |...:::.|.     ..|||      ||.|. 
Zfish    69 D-SDELPSLHSIGT-------------------AGLAVQVVGS-----NWPKP------HYTLL- 101

  Fly   211 IKLQIPAEDQSTDQADAAPIKSRSDPARKPRGRIPRSRTGKSRESAAAEELIQNQTLEPPLKSGK 275
                                                 .||..|  ....:|::    |.|....:
Zfish   102 -------------------------------------ITGLCR--FRVSQLLR----ERPFPVAE 123

  Fly   276 VESSSLPKPPTEEKIVEPETGAKENVNQSAPSAQPVLIVEVENVKQPIYKQTEEVKA---LTQEI 337
            ||.....:..||.   :|..|                  |:..:.|..|:...::..   ::..:
Zfish   124 VEQLDKLEQYTEG---DPADG------------------ELGELSQRFYQAAVQLVGMLDMSVPV 167

  Fly   338 IKTLRDIITMNPLYRESLQQMLHQNQRVVDNPIYLCDLGASLSAGEPAELQKILEETDIPERLQL 402
            :..||.::...|  :|:|..:                |.|.:......:|| :|:..|:.||.:.
Zfish   168 VAKLRRLLDSLP--KETLPDV----------------LAAMIRTSNKEKLQ-VLDAVDLEERFKK 213

  Fly   403 ALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKK---------ELGIEKDDKDAI 458
            ||.||.:::|..:|.||     ..|::....|.:|.     |:|         .|..|.:|:|:.
Zfish   214 ALPLLTRQIEGLKLLQK-----TRKLRPDDDKRVLS-----IRKGGVFPGRQFSLDEEVEDEDSD 268

  Fly   459 GEKYRE-KLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLE 522
            .....| |:|...:|||.:.|..:||.:|..:.....|:.:|||||:.:..|||...:|:.|.:.
Zfish   269 DTALLERKVKAAAMPEAALRVCLKELRRLKKMPQSMPEYALTRNYLEMMVELPWSKSTTDCLDIR 333

  Fly   523 KATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFR 587
            .|...|::|||.||.:|||:||::||..||.:.:|.||||.|||||||||:.:||||.|.||:.|
Zfish   334 AARVLLDNDHYAMEKLKKRVLEYLAVRQLKSTLKGPILCFVGPPGVGKTSVGRSIARTLGREFHR 398

  Fly   588 FSVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELL 652
            .::||:.|.::|:||||||||:|||::|..||...:.||:.|:|||||:||..||||::||||:|
Zfish   399 IALGGVCDQSDIRGHRRTYVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVL 463

  Fly   653 DPEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMP 717
            |||||.:|.||||:||.|||:||||.|||...|||..|.||||::::.||..|||:.||.::|:|
Zfish   464 DPEQNHSFTDHYLNVPFDLSQVLFIATANTTATIPPALLDRMEVLQVPGYTQEEKVEIAHRHLIP 528

  Fly   718 QAMKDCGLTDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVKKEG--------- 773
            ..::..|||.:.:.|.:|....:|..|.||:|||:|::.|..|.|.||.:|.  ||         
Zfish   529 HQLEQHGLTPQQLQIPQDTTLQIISKYTREAGVRSLERKIGAVCRAVAVKVA--EGQKVSRSEAP 591

  Fly   774 --EHFPVNADN---------------------LTTFLGKQIFSSDRMYATTPVGVVMGLAWTAMG 815
              :|...|.|:                     |...||..:|..:.....|..||.:|||||.||
Zfish   592 TEQHAEQNTDSKVEDSGIAAPPEMPIVIDHVALKDILGPPLFEMEVSERLTLPGVAIGLAWTPMG 656

  Fly   816 GSSLYIETSRRHIRQGAKTDPNTVAGSLHITGNLGDVMKESAQIALTVARN--FLYSLEPNNL-F 877
            |..:::|.||   .:|        .|.|.:||.|||||||||.:|::..|:  ..|.|...:. .
Zfish   657 GEIMFVEASR---MEG--------EGQLTLTGQLGDVMKESAHLAISWLRSNAKTYLLNDGSADL 710

  Fly   878 LEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGIKEKT 942
            ||...||||.|.||..|||||||:||:|.|.||.:|:.||.|:|||||::|:|.||||||||:|.
Zfish   711 LEGTDIHLHFPAGAVTKDGPSAGVTIVTCLASLLSGRLVRSDVAMTGEITLRGLVLPVGGIKDKV 775

  Fly   943 IAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVYKIAFTDVTETTTNNVEEQEPL 1007
            :||.|:.:..:|:|..|:||.||:|..:...|:...|.|.::|...||.....:..|:   .:.|
Zfish   776 LAAHRANLKRIIIPKRNEKDLEEIPANVRADLDFVLAGTLDEVLNAAFDGGFPSAVNH---PQVL 837

  Fly  1008 QKL 1010
            .||
Zfish   838 SKL 840

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 14/59 (24%)
lon 95..990 CDD:273258 323/947 (34%)
P-loop_NTPase 530..>581 CDD:304359 32/51 (63%)
AAA 560..702 CDD:278434 88/142 (62%)
ChlI 778..991 CDD:304493 97/237 (41%)
lonp2NP_001008573.1 Lon 4..826 CDD:223542 325/960 (34%)
LON 9..225 CDD:271862 59/334 (18%)
AAA 371..513 CDD:278434 88/142 (62%)
ChlI 618..825 CDD:304493 95/218 (44%)
Microbody targeting signal. {ECO:0000255|HAMAP-Rule:MF_03121} 838..840 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0466
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126991
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.