DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and lon1

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_593035.1 Gene:lon1 PomBaseID:SPAC22F3.06c Length:1067 Species:Schizosaccharomyces pombe

Alignment Length:1038 Identity:445/1039 (43%)
Similarity:628/1039 (60%) Gaps:131/1039 (13%)


  Fly    24 NRPIQSSLMQYCRDRSLRLQRLHGANLMVQRFYS--RKRDDSNGDIIMGPDLMSDQ-------DT 79
            |..:.|:..:..:|.....|.|..::...:..||  :.....|.:..:|.:...|:       :.
pombe    83 NESLPSTDKKKKKDNDDFKQNLKSSSNKTEEKYSATQASKSKNDEFELGGEENEDEMPLNGEFNK 147

  Fly    80 HLPATVAVPDVWPHVPLLAMRKNPLFPRFMKIVEVSNPIIMDLLRRKVKLNQPYVGVFLKKTDG- 143
            ::||..:||||:|.:..|.:.:.||||.|.|.:...||.:.:.::..:|..|||:|.||.|.:. 
pombe   148 NVPAKYSVPDVYPQLLALPIARRPLFPGFYKAIVTKNPSVSEAIKELIKKRQPYIGAFLLKDENT 212

  Fly   144 EEELITNLNDVYNLGTFAQIQEL--QDLGDK--LRMVVVAHRRIRITGQVVEDVPPPKPVKMTTL 204
            :.::|||::.||.:|.||||..:  ...|.:  |..|:..|||||||     ::.|||       
pombe   213 DTDVITNIDQVYPVGVFAQITSIFPAKSGSEPALTAVLYPHRRIRIT-----ELIPPK------- 265

  Fly   205 HYPLFNIKLQIPAED-QSTDQADAAPIKSRSDPARKPRGRIPRSRTGKSRESAAAEELIQNQTLE 268
                         || .|...:|||.::                 |.||      ..|..|..::
pombe   266 -------------EDADSAASSDAAELE-----------------TDKS------SNLSSNGEVK 294

  Fly   269 PPLK--SGKVESSSLPKPPTEEKIVEPETGAKENVNQSAPSAQPVLIVEVENV-KQPIYKQTEEV 330
            ..||  :||.|         .||.||......:|..        |.:|.|||| .:|..:|...:
pombe   295 SDLKQDNGKEE---------PEKEVESTPSILQNFK--------VSLVNVENVPNEPFKRQDPVI 342

  Fly   331 KALTQEIIKTLRDIITMNPLYRESLQ--QMLHQNQRVVDNPIYLCDLGASLSAGEPAELQKILEE 393
            ||:|.||:...:||..::||:||.:.  .:...:..|.|.|..|.|..|::||.:..|||::||.
pombe   343 KAVTSEIMNVFKDIANVSPLFREQIANFSISQTSGNVFDEPAKLADFAAAVSAADHRELQEVLEA 407

  Fly   394 TDIPERLQLALTLLKKELELSRLQQKIGREVEEKVKQQHRKYILQEQLKVIKKELGIEKDDKDAI 458
            |:|.:|||.||.:|||||..::||.||.:|:|:|:.|:|::|:|.||||.||:|||.|.|.|:|:
pombe   408 TNIGDRLQKALYVLKKELLNAQLQHKINKEIEQKITQRHKEYLLTEQLKQIKRELGQELDSKEAL 472

  Fly   459 GEKYREKLKDKVVPEAIMTVIDEELTKLNFLESHSSEFNVTRNYLDWLTSLPWGVISTENLCLEK 523
            ..:::::.:...:|:.:..|.::||:|...||..::|||:|||||||:|.||||..|.||..|:.
pombe   473 VTEFKKRTESLSMPDHVKKVFNDELSKFQHLEPMAAEFNITRNYLDWITQLPWGKRSVENFDLDH 537

  Fly   524 ATETLNDDHYGMEDIKKRILEFIAVSSLKGSTQGKILCFHGPPGVGKTSIAKSIARALNREYFRF 588
            |.|.|:.||||::|:|.|:||.:||..|:|:.||||:|..|||||||||:.||||.|||||:|||
pombe   538 AKEVLDRDHYGLKDVKDRVLELVAVGKLRGTMQGKIMCLVGPPGVGKTSVGKSIASALNREFFRF 602

  Fly   589 SVGGMTDVAEIKGHRRTYVGAMPGKLIQCLKKTKIENPLVLIDEVDKIGKGYQGDPSSALLELLD 653
            ||||:|||||||||||||:||||||::|.|||.:.||||:||||:||:||.:||||:||||||||
pombe   603 SVGGLTDVAEIKGHRRTYIGAMPGKIVQALKKVQTENPLILIDEIDKVGKSHQGDPASALLELLD 667

  Fly   654 PEQNANFLDHYLDVPVDLSRVLFICTANVIDTIPEPLRDRMELIEMSGYVAEEKIAIARQYLMPQ 718
            .|||:.|||:|:|:|:|:|.|||:||||.|||||.||.||||:||:||||:.||:.||:.||:||
pombe   668 SEQNSAFLDYYMDIPLDVSSVLFVCTANTIDTIPPPLLDRMEVIELSGYVSAEKVNIAKGYLIPQ 732

  Fly   719 AMKDCGLTDKHINISEDALNMLIRSYCRESGVRNLQKHIEKVIRKVAFRVVK------------- 770
            |...|||.|.::|||:||:..||..|..|||||||:|.|||:.||.:|.:||             
pombe   733 AKAACGLKDANVNISDDAIKGLISYYAHESGVRNLKKSIEKIFRKTSFSIVKEIDDELNSKEKST 797

  Fly   771 -----------------KEGEHFP------VNAD----NLTTFLGKQIFSSDRMYATTPVGVVMG 808
                             ||....|      ||.:    :||.:||..|::|.|:|.|||.|||||
pombe   798 GKSGKKTSPQSSEDAANKEASSVPLKVPDKVNIEIEEKDLTKYLGPPIYTSQRLYDTTPPGVVMG 862

  Fly   809 LAWTAMGGSSLYIETSRRHIRQGAKTDPNTVAGSLHITGNLGDVMKESAQIALTVARNFLYSLEP 873
            |.||.|||.|:|:||..::|.....|.      ||..||.||||||||::|:.:.:::||....|
pombe   863 LGWTPMGGVSMYVETIVKNILSSNSTP------SLERTGQLGDVMKESSEISYSFSKSFLSKHFP 921

  Fly   874 NNLFLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVRQDIAMTGEVSLKGKVLPVGGI 938
            ||.|.|...:|:|.|||:..|||||||||:.|:|:|||...||....|||||::|.||:|.:||:
pombe   922 NNKFFEHARLHMHCPEGSISKDGPSAGITMATSLLSLALDTPVPATTAMTGELTLTGKILRIGGL 986

  Fly   939 KEKTIAARRSGVNCLILPVDNKKDFEELPTYITDGLEVHFATTYEDVYKIAFTDVTETTTNNV 1001
            :|||:||:.||:..::.|..|..|:|:||.|:.:||.......|:||:|..|:::.....||:
pombe   987 REKTVAAKLSGMKEILFPKSNLADWEQLPDYVKEGLTGVPVAWYDDVFKRVFSNIDAEKCNNL 1049

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740 17/56 (30%)
lon 95..990 CDD:273258 425/946 (45%)
P-loop_NTPase 530..>581 CDD:304359 32/51 (63%)
AAA 560..702 CDD:278434 106/142 (75%)
ChlI 778..991 CDD:304493 103/217 (47%)
lon1NP_593035.1 LON 161..>217 CDD:197740 17/56 (30%)
lon 163..1038 CDD:273258 425/946 (45%)
AAA 574..716 CDD:278434 106/142 (75%)
ChlI 832..1035 CDD:304493 99/209 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H3521
Inparanoid 1 1.050 777 1.000 Inparanoid score I77
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003703
OrthoInspector 1 1.000 T1124771
orthoMCL 1 0.900 OOG5_126991
Panther 1 1.100 LDO PTHR43718
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R662
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.