DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lon and T23G4.2

Sequence 1:NP_730435.2 Gene:Lon FlyBaseID:FBgn0036892 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_502646.2 Gene:T23G4.2 WormBaseID:WBGene00011958 Length:101 Species:Caenorhabditis elegans

Alignment Length:91 Identity:23/92 (25%)
Similarity:48/92 (52%) Gaps:5/92 (5%)


  Fly   853 MKESAQIALTVARNFLYSLEPNNLFLEQEHIHLHVPEGATPKDGPSAGITIITALVSLATGKPVR 917
            ||:..::|.:||.   ..|..:.:..::.::.:...|... .||.|:.:.:..::.....|..|.
 Worm     1 MKKGIELARSVAH---LELCQDKITFQRRYVAIEFDEDEL-LDGKSSILAVAVSIYFAIVGLRVP 61

  Fly   918 QDIAMTGEVSLKGKVLPVGGIKEKTI 943
            .|:.:||.::|||.|:|:.|: :||:
 Worm    62 SDLMITGSLNLKGTVIPISGL-DKTV 86

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LonNP_730435.2 LON 93..>148 CDD:197740
lon 95..990 CDD:273258 23/92 (25%)
P-loop_NTPase 530..>581 CDD:304359
AAA 560..702 CDD:278434
ChlI 778..991 CDD:304493 23/92 (25%)
T23G4.2NP_502646.2 ChlI <1..>82 CDD:304493 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43718
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.