DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and RPL37B

DIOPT Version :10

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_010788.1 Gene:RPL37B / 852111 SGDID:S000002908 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:19/81 - (23%)
Similarity:27/81 - (33%) Gaps:20/81 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PKDRRKTDDEKLLINVSGRR-FETWRNTLEK--YPDTLLGSNEREFFYDEDCKEYFFDRDPDIFR 93
            |...::.:....|.|..||| |...:.|...  ||    .:..|...:....|.          |
Yeast     6 PSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYP----SAKTRSHNWAAKAKR----------R 56

  Fly    94 HILNYYRTGKLHYPKH 109
            |...   ||::.|.||
Yeast    57 HTTG---TGRMRYLKH 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727 19/81 (23%)
Ion_trans 188..415 CDD:459842
DUF3399 471..535 CDD:463381
RPL37BNP_010788.1 PTZ00073 1..83 CDD:240257 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.