DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shal and Kcnk2

DIOPT Version :10

Sequence 1:NP_001097646.1 Gene:Shal / 40129 FlyBaseID:FBgn0005564 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_742039.1 Gene:Kcnk2 / 170899 RGDID:621448 Length:426 Species:Rattus norvegicus


Alignment Length:197 Identity:41/197 - (20%)
Similarity:68/197 - (34%) Gaps:81/197 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 GLRILGYTLKSCASELG-------------FLVFSLA---------MAIIIFATVMFYA-----E 346
            |:.:.|:.|.....:||             |:.::::         :..|:|..|:|.|     .
  Rat   181 GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIF 245

  Fly   347 KNVNGTNFTSIPAAFWYTIVTMTTLGYGDMVPETIAGK----------------IVGGVCSLSGV 395
            |::.|   .|...|.::.::|:||:|:||.|    ||.                |:.|:...:.|
  Rat   246 KHIEG---WSALDAIYFVVITLTTIGFGDYV----AGGSDIEYLDFYKPVVWFWILVGLAYFAAV 303

  Fly   396 L--------VIALPVPVIVSNFS-----------------------RIYHQNQRADKRKAQRKAR 429
            |        ||:......|..|.                       .||.:.|||...|.:..|.
  Rat   304 LSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSVKRKLSAE 368

  Fly   430 LA 431
            ||
  Rat   369 LA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShalNP_001097646.1 BTB_POZ_Shal-like 6..144 CDD:349727
Ion_trans 188..415 CDD:459842 34/179 (19%)
DUF3399 471..535 CDD:463381
Kcnk2NP_742039.1 Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000269|PubMed:23021213 17..38
Important for GNG4 binding and L-glutamate release in astrocytes. /evidence=ECO:0000269|PubMed:23021213 51..61
Ion_trans_2 <138..196 CDD:462301 3/14 (21%)
Selectivity filter 1. /evidence=ECO:0000305|PubMed:26919430 157..162
Ion_trans_2 234..312 CDD:462301 20/84 (24%)
Selectivity filter 2. /evidence=ECO:0000305|PubMed:26919430 266..271 2/4 (50%)
Interaction with AKAP5. /evidence=ECO:0000250|UniProtKB:P97438 313..326 3/12 (25%)
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250|UniProtKB:P97438 337..385 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.