DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and RKR1

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_013975.1 Gene:RKR1 SGDID:S000004861 Length:1562 Species:Saccharomyces cerevisiae

Alignment Length:1913 Identity:352/1914 (18%)
Similarity:657/1914 (34%) Gaps:619/1914 (32%)


  Fly    60 PDSFDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQ--------SDVEVLKNILPLWPKYY 116
            |...::..|.:.::|.:.|.|:|..||:|||.:|..||..        :|:.:|     .|.:.|
Yeast    36 PSLLNSLYSNELKLIFKSLLKRDETTKEKALMDLSNLISDFNQNEYFFNDIFLL-----CWSQIY 95

  Fly   117 LNLASDPEHTVREQTQTVLQLLMAKCKKAMAPYLKLLVP-VWLGS---RFDTYAPAASIASQSF- 176
            ..|.......:|.|:..:..:|:...:|.::.:||..:| :.||:   .:....|:.:..::.| 
Yeast    96 AKLIISDYKVIRLQSHQITIMLVKSLRKKISKFLKDFIPLILLGTCELDYSVSKPSLNELTECFN 160

  Fly   177 RDTFAGNANRSREVCMHCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSLKLL- 240
            :|....||     :....|.::|......:......|:|..:..:.|::|.:|.|||.|::.|| 
Yeast   161 KDPAKINA-----LWAVFQEQLLNLVKEIVVNENEDTISDERYSSKEESEFRYHRVIASAVLLLI 220

  Fly   241 -SFFMGQTAQTEELSQVKEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQ 304
             .|...:.......|.:|    .:::.:..|.                         ||::...|
Yeast   221 KLFVHNKDVSERNSSSLK----VILSDESIWK-------------------------LLNLKNGQ 256

  Fly   305 KTQLTNLCFQFIDDADPVVAPHIWGCVLLLQSNYVDWFVP--LNIRKTLLPKLSSLLQNGFNRNA 367
            .|.......:.||             ||     |...::|  .||.|..:.||...|.:..::|.
Yeast   257 NTNAYETVLRLID-------------VL-----YTRGYMPSHKNIMKLAVKKLLKSLTHITSKNI 303

  Fly   368 QAICPNLLPFLSKVTQASLQDLDIYDFYQRFFDDMKLAVTKKFDPPLSKSDCIVIHNAYFECLRF 432
            ..:|| :||.:..:    |..||.|:                 |..:...|              
Yeast   304 LKVCP-VLPSILNL----LATLDDYE-----------------DGTIWSYD-------------- 332

  Fly   433 LMQQINNNKQREQKEEEFSFSLLDNNVLEP-----IAWLLKSDSTHVKIFFQHSSALVAFWDRQI 492
                      :..||:...|..:......|     :..|..|...|  .|..:....:.||.:.:
Yeast   333 ----------KSSKEKVLKFLSVSRTSPSPGFFNAVFALYSSTKRH--SFLDYYLEWLPFWQKSV 385

  Fly   493 NNRLDNG---DLYAKLLNKFWIRIFELVTQDLSAEEVNEQLLGHVLLLVQDLHMANPSLESPSVK 554
            ....:.|   ...|::||:||...                                       :|
Yeast   386 QRLNEKGFSARNSAEVLNEFWTNF---------------------------------------LK 411

  Fly   555 FVEGPNEKIEKSEPTTPVKKAQEAAAFIQKELKQLVIKLVRICLDKANKGSGSGTSSSRYIEQIR 619
            |.|..:|:        .|||..|:..|                     .....|.|.|.|.:..:
Yeast   412 FAEDSSEE--------RVKKMVESEIF---------------------NSLSCGKSLSEYTKLNQ 447

  Fly   620 TLTKMFNDAAFYKSL----TDDGDLASALNKFVSLLGQLSCQACESVVEIVFEILPLLETGKRFE 680
            ||:.:|....:.:.:    |.|.|:..                    :::.||            
Yeast   448 TLSGVFPPDKWEREIEDYFTSDEDIRK--------------------IKVSFE------------ 480

  Fly   681 YIENTLMKLPQHGVQNLLLHRLLSYPLCAEAAVRQMLSGPETCEMIARIAEEVVVDNDREKLNLL 745
                          :||.               ..:::.|.....|:|:.:..|...:.:..|:.
Yeast   481 --------------KNLF---------------ALLVTSPNNESAISRLFDFFVQLIETDPSNVF 516

  Fly   746 HKCFFQTDTGDILINAKTVDKILLSMCGPLEQPVVDDAVEVCGSFIAQIMPVICSNNNSSLHVRQ 810
            :|                                .|...:....|:...|               
Yeast   517 NK--------------------------------YDGVYDALNYFLDSDM--------------- 534

  Fly   811 HIFL--KLFKFSLEHRPEDYLSEDTLWEITTCWQDGLSSKDIEIDDDMLKCCAGIVEELANSAEL 873
             |||  |:.||              :.||.|.           :.:...:..|||:.:.:||...
Yeast   535 -IFLNGKIGKF--------------INEIPTL-----------VQESTYQNFAGIMAQYSNSKFF 573

  Fly   874 KADT----------LDGMAEAMAKFVICSTEN--IEDEYKRLERIDETLTALLETPLKTTDKVQQ 926
            |.:|          :..::..:.|.:|.:|.|  ..|.|::|.:.|.     ||..|...|.::.
Yeast   574 KMNTDAITSLEDFFIVALSFNLPKTIILATMNELDNDIYQQLMKSDS-----LELELYIEDFMKN 633

  Fly   927 FE----------NHCVL----LEALHGSVTAGVPFENACLSRNEILPLLQR---STLNFSTIYKL 974
            ::          |:..|    :..|:.|..|....|..|    .:|..|..   |||..:|.:..
Yeast   634 YKFDDSGEIFKGNNKFLNQRTITTLYRSAVANGQVEQFC----AVLSKLDETFFSTLLLNTDFLS 694

  Fly   975 VYQFPPPQDTNDPEDELTEDYCDPNADVLKKWNEPLIAELLQCIRV---AGTAECWLEMSVLQSS 1036
            ...:...:|||:...:|:......|:::..|    |...:||..:|   .|..|.::..:|    
Yeast   695 CALYEVSEDTNEKLFKLSLQLAKGNSEIANK----LAQVILQHAQVYFSPGAKEKYVTHAV---- 751

  Fly  1037 TEELVLILSEKVQSFM-GNSSDLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASI 1100
              ||:...::..|.|. .|:.::.|    |...|...:||::              ::...:..:
Yeast   752 --ELINGCNDTSQIFFPANAIEVFA----RYMPAIDYRSSLV--------------SSLSTNTHL 796

  Fly  1101 LLHEDLSENLVTQGALKTYVIALQFLLPKLSQKA-------ITLSSAI------MGTEPPEIWVK 1152
            ||.:|...||.....|..|.:.|..||..|.::.       ||:.|.:      :..||.:::..
Yeast   797 LLTDDKPINLKNMQKLIRYALFLDALLDALPERVNNHIVAFITVVSELVTDYNCLSEEPNDLYYD 861

  Fly  1153 ------------------------------------------------AAVFHALLLNNFEGDVN 1169
                                                            :.|.:.:|||:.: .|:
Yeast   862 FGHTFFKHGKVNLNFSDIVGNVIQPANGGDAMLTFDIAESNSVYFFYYSRVLYKVLLNSID-TVS 925

  Fly  1170 EQTDRNIIVSAVQFMT-SIGERQASQKD-------LLHYN------------------------V 1202
            ..|...::.|...|:| ::.:::::.||       ||.:|                        |
Yeast   926 STTLNGLLASVESFVTKTVRDQKSTDKDYLLCAILLLMFNRSNSKDEITKLRTLLASQLIGIREV 990

  Fly  1203 EIQRQPYESVINTVEFIKLLTEVL------KRF----PYELSIKNWDAIRIGLSSWVLSVSKSIA 1257
            |:..|.::|       :.||..:|      |:|    |..|::                :.:||.
Yeast   991 ELVDQEFKS-------LALLNNLLDIPQADKQFVPIAPQRLNM----------------IFRSIL 1032

  Fly  1258 QYQD------PKTSLFIVAVYELFAALIDF--IR---------SEKQKSSTELLKNMIDEWDSLF 1305
            ::.|      |..|...:.:.:.|..|:.|  :|         ||:..:.: |....||  |:|:
Yeast  1033 KWLDSDLAYEPSFSTVRLLLLDFFTKLMRFEGVRDMGITAFELSERLLADS-LSMCQID--DTLY 1094

  Fly  1306 AKEVNLVLFKSYYLLTHEVSVDPGFQACYEALLEQITPVIERLDYSFVYSFCKSNSNITLDHLCN 1370
            ..|:.......|..|:..||.:.      |.:.|....:.|.|......:|.:..:|    .:..
Yeast  1095 LLELRSSCLNLYETLSQGVSKNG------EEISEYGDEIQENLIELMFLNFNQERNN----QVST 1149

  Fly  1371 FLFKQLYSVQHSVRLSAVHSLRQLTPHFVADDIEL--NEKQSESLDASTTICKWHFLNRFEDYLT 1433
            ..:::||.|..|:.|..:.|..:.....|.:|.::  |..||..|   ||:.....:...:|.:.
Yeast  1150 LFYQKLYKVISSMELKKLESQYKRIFEVVLNDKDIGSNINQSRLL---TTLLGSLVVKTQQDIII 1211

  Fly  1434 RYDALI------------------------TKYLEEFTFKLSELDDLEPIDRHNALSYLFLWDCI 1474
            .|:..|                        .|.|::.|.::.: :.||..::::.:.||:.|..|
Yeast  1212 EYELRIQKQTGSDVDGSASDNDVNSKFKLPQKLLQKVTDEVPK-EYLEYENKNSFIKYLWYWHLI 1275

  Fly  1475 INACAKSPVALRAVYTNWLNDNKYEENFLHFL-----------FRAMPVDILKNHGAKVHSNGVY 1528
            :.....:...:|.::...|.:.........|:           ::.:....:..:....::...|
Yeast  1276 LMYFKDTSYNMRQIFIEQLKEAGLINRMFDFITDQIDLRDTEFWKQVDTKEISEYNIVGNNFSPY 1340

  Fly  1529 KELTWSQQKDRHLPLERYACHLYTEVLRKLPAVVRRWW-NATQSRQKNFIDNLTTNYVSSLICSE 1592
            ||..:.:.|       :...|...::...:..:...|| |......:|.|:...:.::|.::...
Yeast  1341 KEDIFEECK-------KLLGHTLYQLFNNVGCLTSIWWLNIKDRTLQNDIEKFVSEFISPILIKN 1398

  Fly  1593 ELKAIANRKEK----HENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPLGAVKVECGKQIG 1653
            |...|.::.::    .:.:.:.:::.|.||.|.|.||:.::|:...|..||||..::|....::|
Yeast  1399 EFDDINSKMDRLTSNDDALTIKLNNITNEVKASYLIDDQKLEISFKLPKNYPLTNIQVNGVSRVG 1463

  Fly  1654 -GRASSRNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIHQETCQLPKLTCK 1717
             .....:...|.....:|..||::.|.|.::..|:..:|.|.|||.:||:::|....:||..||.
Yeast  1464 ISEQKWKQWIMSTQHVITGMNGSVLDSLELFTKNVHLQFSGFEECAICYSILHAVDRKLPSKTCP 1528

  Fly  1718 TCKKKFHGPCLYKWFTTSSKSTCPICRN 1745
            |||.||||.||||||.:|..:|||:||:
Yeast  1529 TCKNKFHGACLYKWFRSSGNNTCPLCRS 1556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 13/20 (65%)
RKR1NP_013975.1 COG5219 1..1561 CDD:227544 352/1914 (18%)
RING 1507..1558 CDD:238093 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369940224
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I921
Isobase 1 0.950 0 Normalized mean entropy S6253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1136738
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12389
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.