DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and AT5G58410

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_200649.1 Gene:AT5G58410 AraportID:AT5G58410 Length:1873 Species:Arabidopsis thaliana

Alignment Length:2168 Identity:464/2169 (21%)
Similarity:761/2169 (35%) Gaps:720/2169 (33%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLGSSTPIFVGFSAQTDGGGLVPFAPGFASAEQMPDS--- 62
            ||.....|.|:|  |:|||||..|.||.|.:...|||      ||.|. :..|.::....||   
plant     1 MGKPKGDAARSK--ARPSSSSLAASLLPSGSAAAVGF------GGYVG-SSRFQTSLSNEDSASF 56

  Fly    63 --FDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEH 125
              .|:.::..    |::||:|||.||.|||..|.||::|...:.|..|:|.|...|..|..|...
plant    57 LDLDSEVAQH----LQRLSRKDPTTKIKALASLSELVKQKQGKELLPIIPQWTFEYKKLILDYSR 117

  Fly   126 TVREQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFR--DTFAGN----- 183
            .||..|..|:..::....:.:||:||.::..|..|:||..:..:..|..||:  .:| ||     
plant   118 DVRRATHDVMTNVVTGAGRDIAPHLKSIMGPWWFSQFDLASEVSQAAKSSFQVGSSF-GNSVFLV 181

  Fly   184 --ANRSREVCMH----CQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSL----K 238
              |..::|..:|    |..||..|...||.. |...|| .|||..::.|:.||::|.|||    .
plant   182 EAAFPAQEKRLHALNLCSAEIFAYLEENLKL-TPQNLS-DKSLASDELEEMYQQMISSSLVGLAT 244

  Fly   239 LLSFFMGQTAQT--------EELSQVKEGFGTLVA------HQKFWSFAKHKVPAIKAAWFECIY 289
            ||...:.:...|        .:|:.......|..|      |:.|.:|.|.:.|:|::|.:..:.
plant   245 LLDILLREPDNTGSANINSESKLASKARAVATSSAEKMFSSHKCFLNFLKSESPSIRSATYSLLS 309

  Fly   290 HILQSV--------------ALLDVITPQKTQLTNLCFQFIDDADPVVAPHIWGCVLLLQSNYVD 340
            ..:::|              |||.|..               :.:|.....:|..|||....:..
plant   310 SFIKNVPEVFGEGDVRSLAPALLGVFR---------------ENNPTCHSSMWEAVLLFSKKFPQ 359

  Fly   341 WFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVTQASLQDLDIYDFYQRFFDDMKLA 405
            .:|.||:.|::|..|...|:||...:.|...|.|:.|| :|..|  |.::...|:..||.:: ||
plant   360 SWVYLNVHKSVLNHLWQFLRNGCYGSPQVSYPALILFL-EVMPA--QSVESDKFFVNFFKNL-LA 420

  Fly   406 VTKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQREQKEEEFSFSLLDNNVLEPIAWLLKSD 470
            .....:.  |.:|.:.:..|..||..:.::..:..........:....|:| .||..|.|   :|
plant   421 GRSMCES--SSTDQLSLLRATTECFLWGLRNASRYCDVPNSIHDLQVDLID-KVLVKILW---AD 479

  Fly   471 STHVKIFF----QHSSA--------------------------------LVAFWDRQIN----NR 495
            .|.:....    |..||                                |::|:.:.:.    |.
plant   480 FTELSKGSIPPNQRKSAENLGMGNSVSYLQELGRCILEILSGINLLEQNLLSFFCKAVQESFLNM 544

  Fly   496 LDNGDL------------YAKLLNKF-----------------------WIRIFELVTQDLSAEE 525
            |..|||            :..||.::                       |||             
plant   545 LQQGDLEIVAGSMRKMIDFLLLLERYSVLEGESWPLHQFMGPLLSKAFPWIR------------- 596

  Fly   526 VNEQLLGHVLLLVQDLHMANPSLESPSVKFVEGPNEKIEKSEPTTPVKKAQEAAAFIQKELKQLV 590
             :.:||..|.||...:.:..|....|.:         |:..|.:|.:.        ::||.....
plant   597 -SSELLDGVKLLSVSVSVFGPRKVVPVL---------IDDIETSTLLS--------VEKEKNMSP 643

  Fly   591 IKLVRI--------CLDKANKGSGSGTSSSR-----------YIEQIRTLTKM--------FNDA 628
            .||:::        |:|    |..|.|::.:           :.:|...:...        ||:.
plant   644 EKLIKVFQEIFIPWCMD----GYDSSTAARQDLLFSLLDDECFTQQWSDVISYVFNQQHQGFNNL 704

  Fly   629 AFYKSLTDDG-------DLASALNK-----------------FVSLLGQLSCQACESVVEIVFEI 669
            |..|.|.:..       .....||:                 .:||: ..|.....|.|:.:..:
plant   705 AAMKMLLEKARDEITKRSSGQELNQRIGSRPEHWHHTLIESTAISLV-HSSSATTTSAVQFLCSV 768

  Fly   670 LPLLETGKRFEYIENTLMKLPQHGVQNLLLHRLLSYPLCAEAAVRQMLSGPETCE---------- 724
            |..........::..:.:.|...|:...||..:...|||         |..:||.          
plant   769 LGGSTQDSSISFVSRSSLVLIYRGILEKLLSFIKQSPLC---------SVNDTCSSLIVEAIAFD 824

  Fly   725 --------MIARIAEEVV------------------------------------VDN----DREK 741
                    ::|:.|.||:                                    |||    .:||
plant   825 SSSSVDVIVVAKFAAEVIDGSFFSLKSLSQDATLLTTVLSSIFIIDLENRMTSLVDNTLSESKEK 889

  Fly   742 -------LNLLHK-C------FFQTDTGDI-LINAKTVDKILLS---------------MCGPLE 776
                   .:.:|. |      |:::...|: ..:|.|:.:.|.|               :|....
plant   890 RKDRNFVCDYVHAVCSKMDNQFWKSINYDVRKSSASTLAQFLRSVVLLEDDLQPFELTLLCASRM 954

  Fly   777 QPVVD-------DAVEVCGSFIAQI-------------------MPV-ICS--NNNSSLHVR--Q 810
            ..|::       |...:||..:.:.                   ||| :|.  .:.|..:|.  .
plant   955 TEVLEYLSLDQSDEENICGLLLLESDAWPIWVSPSSSASIDTHGMPVQLCELRKSKSQRYVSFID 1019

  Fly   811 HIFLKL--FKFSLEHRPEDYLSEDTLW---EITTCW----------------------------- 841
            .:.:||  .:|.:.|:...:.|:  .|   ||...|                             
plant  1020 SLIMKLGIHRFIVGHKDHGFASQ--AWLSVEILCTWEWPGGKVQTSFLPNLVSFCKDEPSSGGLL 1082

  Fly   842 ------------------QDGLSSKDIEIDDDMLKCCAGIVEELANSAEL--KADTLDGMAEAMA 886
                              ::||.:..::.:::::......:..|.:...:  |.| |.|..||||
plant  1083 NSIFDILLNGALVHVKDEEEGLGNMWVDFNNNIVDVVEPFLRALVSFLHILFKED-LWGEEEAMA 1146

  Fly   887 KFVICSTENI---EDEYKRLERIDETLTALLETPLKTTDKVQQFENHCVLLEALHGSVTAGVPFE 948
            .|.:. |:.:   |:..|...||...:.:::.:||:|  ||:.           .||        
plant  1147 AFKMI-TDKLFIGEETSKNCLRIIPYIMSIIISPLRT--KVKS-----------GGS-------- 1189

  Fly   949 NACLSRNEILPL--LQRSTLNFSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNADVLKKWNEPLI 1011
                .::.:|||  |.|:.|..|      ..|||.......||             ::.|.:.:|
plant  1190 ----GKDTLLPLEVLLRNWLERS------LSFPPLVLWQSGED-------------IQDWFQLVI 1231

  Fly  1012 AELLQCIRVAGTAECWLEMSVLQS--STEELVLILSEKVQSFMGNSSDLVAIVKERLQQAAVQQS 1074
            :    |..|:..||   |...||.  ||||..|:|            ||.     |.|:.....|
plant  1232 S----CYPVSDKAE---EAKELQRHLSTEERTLLL------------DLF-----RKQKQDPGAS 1272

  Fly  1075 SVIDCRLLSYLRFCPQYAAFEESASILLHEDLSENLVTQGALKTYVIALQFLLPKLSQKAITLSS 1139
            :|:                                        |.:.|:|.||.:|    |.::.
plant  1273 TVV----------------------------------------TQLPAVQILLARL----IMIAV 1293

  Fly  1140 AIMGTE-PPEIW------VKAAVFHALLLNNFEGDVNEQTDRNI--IVSAVQFMTSIGERQASQK 1195
            :..|.: ..:.|      :|..:..|::       |.|:|..|:  .:|.|..|..  |::....
plant  1294 SYCGNDFNEDDWDFVFSNLKRLIQSAVV-------VMEETSENVNDFISGVSSMEK--EKENDTL 1349

  Fly  1196 DLLHYNVEIQRQPYESVINTVEFIKLLTEVLKRFPYE-------LSIKNWDAIRIGLSSWVL--- 1250
            :.|.:.|.|......|..|.:....||..::.....|       |:.:.||.::..:...||   
plant  1350 EGLGHIVFISDPSINSAQNALSAFSLLNALVNHKSVEGEDNLKSLADETWDPVKDRILEGVLRLF 1414

  Fly  1251 ---SVSKSIAQYQDPKTSLFIVAVYEL----FAALIDFIRSEKQKSSTELLKNMIDEW------- 1301
               .::::||....|:.: .|||.:.:    |..|:..:..:....:.:.....::.|       
plant  1415 FCTGLTEAIAASYSPEAA-SIVASFRVDHLQFWELVAHLVVDSSPRARDRAVRAVEFWGLSRGSI 1478

  Fly  1302 DSLFAKEVNLVLFKSYYLLTHEVSVDPGFQ-ACYEALLEQITPVIERLDYSFVYSFCKSNSNITL 1365
            .||:|     ::|.|..:        |..| |.|..|                            
plant  1479 SSLYA-----IMFSSNPI--------PSLQLAAYTVL---------------------------- 1502

  Fly  1366 DHLCNFLFKQLYSVQHSVRLSAVHSLRQLTPHFVADDIELNEKQSESLDASTTICKWHFLNRFED 1430
                        |.:...||:.|..|.  .|   .:|..||::.|.:....:           ||
plant  1503 ------------STEPISRLAIVADLN--AP---LNDESLNDQDSSNAGLPS-----------ED 1539

  Fly  1431 YLTRYDALITKYLEEFTFKLSELDDLEPIDRHNALSYLFLWDCIINACAKSPVAL----RAVYTN 1491
            .|...|. ::..:|:...:|.:.|...|    ..:.....|..:::.....|...    |.|   
plant  1540 KLLLRDE-VSCMVEKLDHELLDTDLTAP----ERVQTFLAWSLLLSNVNSLPSLTQGRERLV--- 1596

  Fly  1492 WLNDNKYEEN-----FLHFLFRAMPVDILKNHGAKVHSNGVYKELT------------------- 1532
                 :|.|.     .|..||:.:|:::......|.....:..||:                   
plant  1597 -----QYIEKTANPLILDSLFQHIPLELYMGQSLKKKDGDIPSELSVVASAATRAIITGSSLSTV 1656

  Fly  1533 ---WSQQKDRHLPLERYACHLYTEVLRKLPAVVRRWWNATQSRQ-KNFIDNLTTNYVSSLICSEE 1593
               |..:..:...|   |..:|..:||.|||.||.|::..:.|. .:.|:..|..:.|..:...|
plant  1657 ESLWPIETGKMASL---AGAIYGLMLRVLPAYVREWFSEMRDRSASSLIEAFTRTWCSPSLIKNE 1718

  Fly  1594 LKAIANRKEKHENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPLGAVKVECGKQIG-GRAS 1657
            |..|.......|:..|::..:..||:|.|..||..|:|||.|..:|||..|.|.|.|.|| ..|.
plant  1719 LSQIKKADFNDESFSVSISKAANEVVATYTKDETGMDLVIRLPVSYPLKPVDVNCAKSIGISEAK 1783

  Fly  1658 SRNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIHQETCQLPKLTCKTCKKK 1722
            .|...|.:.:|:.||||.:.:.:.:||.|.||:|||||:|.:||:|||.....||:..|.|||.|
plant  1784 QRKWLMSMQMFVRHQNGALAEAIRIWKRNSDKEFEGVEDCPICYSVIHIGNHSLPRRACVTCKYK 1848

  Fly  1723 FHGPCLYKWFTTSSKSTCPICRN 1745
            ||..||.|||.||:|..||:|::
plant  1849 FHKACLDKWFYTSNKKLCPLCQS 1871

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 12/20 (60%)
AT5G58410NP_200649.1 zf-RING_2 1821..1869 CDD:290367 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 286 1.000 Inparanoid score I829
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D19753at2759
OrthoInspector 1 1.000 T192319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12389
Phylome 1 0.910 0.750 Consistency score
66.070

Return to query results.
Submit another query.