DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and Ltn1

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_001074537.1 Gene:Ltn1 MGIID:1926163 Length:1767 Species:Mus musculus

Alignment Length:1938 Identity:512/1939 (26%)
Similarity:844/1939 (44%) Gaps:363/1939 (19%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLG---SSTPIFVGFSAQTDGGGLVPFAPGFASAEQMPDS 62
            ||||.||  |||.|.:||:|.|.||||.   .:.|.|:||.......|.||       |.|..:.
Mouse     1 MGGKNKQ--RTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSHSDLGYVP-------AVQGAED 56

  Fly    63 FDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEHTV 127
            .|:.:....:::||||||||..||.||:||...:..:.|.|.:|.:||.||:.:..::.|.:..|
Mouse    57 IDSLVDSDFRMVLRKLSKKDVTTKLKAMQEFGIMCTERDTEAVKGVLPYWPRIFCKISLDHDRRV 121

  Fly   128 REQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVCM 192
            ||.||...:.|:.|.||.:|||||.::..||.::.|||.|||..|..:|...|.  .::..|...
Mouse   122 REATQQAFEKLILKVKKHLAPYLKSVMGYWLMAQCDTYPPAALAAKDAFEAAFP--PSKQPEAIA 184

  Fly   193 HCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSL----KLLSFFMGQTAQTEEL 253
            .|:.||......:|...|..|||..:::..|:.|.|:.||:..||    :||.|.     ...||
Mouse   185 FCKEEITTVLQDHLLKETPDTLSDPQTVPEEEREAKFHRVVTCSLLALKRLLCFL-----PNNEL 244

  Fly   254 SQVKEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQKTQLTNLCFQFIDD 318
            ..::|.|.:|::..|||.:.||.||.:::|:||.:..:.|.|.  .|:..:..:::......|||
Mouse   245 DSLEEKFKSLLSQNKFWKYGKHSVPQVRSAYFELVSALCQHVP--QVMKEEAAKVSPSVLLSIDD 307

  Fly   319 ADPVVAPHIWGCVLLLQSNYVDWFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVTQ 383
            :||||.|.:|..||...:...|.:..:|.:|::.|||.::::.|....|..:.|.||||:||:.|
Mouse   308 SDPVVCPALWEAVLYTLTTIEDCWFHVNAKKSVFPKLMAMIREGGRGLAAVMYPYLLPFISKLPQ 372

  Fly   384 ASLQDLDIYDFYQRFFDDMKLAV----TKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQRE 444
            :..:..  .||::.|...:...:    ||.     |.|:|..:.:|:||||||:|||       .
Mouse   373 SITEPK--LDFFKNFLTSLVTGLSTERTKS-----SSSECSAVISAFFECLRFIMQQ-------N 423

  Fly   445 QKEEEFSFSLLDNNVLEPIAWLLKSDSTHVKIFFQHSSALVAFWDRQINNRLDNGDLY--AKLLN 507
            ..|||....|::..::..|..:||....|....|.|.:..::.|:.:.:...|.|.:|  ..:|.
Mouse   424 LGEEEMVQMLINEQLIPFIDTVLKDSGLHHGPMFDHLADTLSSWEAKADAERDPGAVYNLENVLL 488

  Fly   508 KFWIRIFELVTQDLSAEEVNEQLLGHVLLLVQDLHMANPSL-----ESPSVKFV----------- 556
            .||.|:.|:.|:.:...|.:.:.:..|..||..|.....||     ::..|:|.           
Mouse   489 SFWGRLSEICTEKIRQPEADVKSVLCVSSLVGVLQRPRSSLKLHRKKTAQVRFAINIPEAHKGDE 553

  Fly   557 -----EGPNEKIEKSEPTTPVKKAQE--AAAFIQKELKQLVIKLVRICLDKANKGSGSGTSSSRY 614
                 ||.|.:.......:|:.....  .:...:|.|:.||.||..:.:...|:     ..|.::
Mouse   554 KSMSSEGENSEGSDGGAQSPLSNTSSDLVSPLRKKPLEDLVCKLAEVSISFVNE-----RKSEQH 613

  Fly   615 IEQIRTLTKMFNDAAFYKSLTDDGD----LASALN-----------KFV--SLLGQLSCQACES- 661
            ::.:.||...|:....:..|..|..    .|..|.           ||:  .|:|.|:....|. 
Mouse   614 LQFLSTLLDSFSSVQVFNILLSDKQKNVVKAKPLEITKLAEKNPAVKFLYHKLIGWLNDSQKEDG 678

  Fly   662 --VVEIVFEILPLLETGKRFEYIENTLMKLPQHGVQNLLLHRLLSY--PLCA----EAAVRQMLS 718
              :|:|::..|...::|...:.:.:.|.|      ::|....||..  ..|:    .|.|...|.
Mouse   679 GFLVDILYSALRCCDSGVERKEVLDDLTK------EDLKWSSLLQVIEKACSSSDKHALVTPWLK 737

  Fly   719 GPETCEMIARIAEEVVVDND----------REKLNLLHKCFFQTDTGDILINAKTVDKILLSMCG 773
            |....|.:..:| :.:.|.|          .|:.:||.....|....|.||....|.:|::.:..
Mouse   738 GSILGEKLVALA-DCLCDKDLEATTSESHSSEQWSLLRLALSQHVKNDYLIGEVYVGRIIVKLHE 801

  Fly   774 PLEQPVVDDAVEVCG-----SFIAQIMPVICSNNNSSLHV--RQHIFLKLFKFSLEHRPEDYLSE 831
            .|.:  ..|..|...     ||:..::....|:....|.:  .:.:.|.||:...:.:...:|.:
Mouse   802 TLSK--TKDLSEAANSDSSVSFVCDVVHSFFSSAGGGLLMPPSEDLLLTLFQLCAQSKERTHLPD 864

  Fly   832 DTLWEITTCWQDGLSSKDIEIDDDMLKCCAGIVEELANSAELKADTLDGMAEAMAKFVICSTENI 896
            ..:.::......|::.               :|.:.|::.|            .:.|:..|...:
Mouse   865 FLICKLKNTLLSGVNL---------------LVHQTASTYE------------QSTFLRLSVLWL 902

  Fly   897 EDEYKRLERIDET-----LTA---LLETPLKTTDKVQQFENHCVLLEALHGSVTAGVPFENACLS 953
            :|:.:. ..:|.|     |:|   ||.|.:::.|        ..||....|||   :|.::....
Mouse   903 KDQVQS-SALDNTSLQVLLSAAGDLLGTLVESED--------TSLLGVYIGSV---MPSDSEWEK 955

  Fly   954 RNEIL-------PLLQ-RSTLN---FSTIYKLVYQFPPPQDTND-PEDELTEDYCDPNADVLKKW 1006
            ..:.|       |||: |.:||   |.|.:|       .|||.. |....|.........|.:|.
Mouse   956 MRQALPVQWLHRPLLEGRLSLNYECFKTDFK-------EQDTKTLPNHLCTSSLLSKMILVAQKK 1013

  Fly  1007 N--------EPLIAELLQCIRVAGTAECWLE------------MSVLQ--SSTEELVLILSEKVQ 1049
            .        |.:|||||..::       |.|            ..:||  :.|...:.:|||   
Mouse  1014 KLVLEDNVLEKIIAELLYSLQ-------WCEELDNAPSFLSGFCGILQKMNITYSNLSVLSE--- 1068

  Fly  1050 SFMGNSSDLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASILLHEDLSENLV--- 1111
                 :|.|:.::.:|.::.....|.:|                    |.::|...:|.:.|   
Mouse  1069 -----TSSLLQLLFDRSRKNGTLWSLII--------------------AKLILSRSISSDEVKPY 1108

  Fly  1112 ----------TQGALKTYVIALQFLLPKLSQK-----AITLSSAIMGTEPPEIWVK--------- 1152
                      |:|:|.|    :|.|.|.||::     :.....|.:|      |.|         
Mouse  1109 YKRKESFFPLTEGSLHT----IQSLCPFLSKEEKKEFSAQCIPAFLG------WTKEDLCSINGA 1163

  Fly  1153 ---AAVFHALLLNNFEGDVNEQT----DRNIIVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYE 1210
               .|:|::.|          ||    |:.::...::.:||   .:...:|:..::..:.....|
Mouse  1164 FGHLAIFNSCL----------QTRSIDDKQLLHGILKIITS---WRKQHEDIFLFSCNLSEASPE 1215

  Fly  1211 SVINTVEFIKLLTEVLKR--FPYELSIKNWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYE 1273
            .:...:|.::.|:..||.  :|..|:...||.|...:.:|:.:.|::.|.|..|...||....::
Mouse  1216 VLGLNIEIMRFLSLFLKHCAYPLPLADSEWDFIMCSMLAWLETTSENQALYSVPLVQLFACVSFD 1280

  Fly  1274 LFAALIDFIRSEKQKSSTELLKNMIDEWDSLFAKEVNLVLFKSYYLLTHEVS-----VDPGFQAC 1333
            |...|..|..|........|..|:|.||...|:|.::.:|..   ||.:.:.     .:..||  
Mouse  1281 LACDLCAFFDSITPDIVDNLPVNLISEWKEFFSKGIHSLLLP---LLVNAIGENKDLSETSFQ-- 1340

  Fly  1334 YEALLEQITPVIERLDY------------SFVYSFCKSNSNITLDHLCNFLFKQLYSVQHSVRLS 1386
             .|:|:   |:.|.|.|            :.:.:..|:|....|..|.|.|...|......|:::
Mouse  1341 -NAMLK---PMCETLTYISKDQLLSHKLPARLVASQKTNLPEHLQTLLNTLTPLLLFRARPVQIA 1401

  Fly  1387 AVHSLRQLTPHFVADDIEL-----NEKQSESLDASTTICKWHFLNRFEDYLTRYDALITKYLEEF 1446
            |.|.|.:|.|.....|.:.     :|::..:|.....:.         ..|:..:.|:...|.  
Mouse  1402 AYHMLCKLMPELPQHDQDNLRSYGDEEEEPALSPPAALM---------SLLSSQEELLENVLG-- 1455

  Fly  1447 TFKLSELDDLEPI--DRHNALSYLFLWDCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRA 1509
            ...:.::..::|:  |....|.||..|..|:.....:...|||:|:.:|...|.....|:.|||.
Mouse  1456 CVPVGQIVTVKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLYHLFRL 1520

  Fly  1510 MP---------VDILKNHGAKVHSNGVYKELTWSQQKDRHLPLERYACHLYTEVLRKLPAVVRRW 1565
            ||         :::.........:..|...:..:.....|:|  ..||.:|...|:.|||:||.|
Mouse  1521 MPENPTYGETAIEVSSKDPKTFFTEEVQLSIRETATLPYHIP--HLACSVYHMTLKDLPAMVRLW 1583

  Fly  1566 WNATQSRQKNFIDNLTTNYVSSLICSEELKAIANRKEKHENMQVTVHSSTREVLAVYAIDEARME 1630
            ||:::.|..|.:|..|:.|||:::..:|:.::....:....|.|...::||||:|.|.|::..:|
Mouse  1584 WNSSEKRVFNIVDRFTSKYVSNVLSFQEISSVQTSTQLFNGMTVKARATTREVMATYTIEDIVIE 1648

  Fly  1631 LVITLAPNYPLGAVKVECGKQIGGRASS-RNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGV 1694
            |:|.|..|||||::.||.||:||..... ||..:||:.:||||||:|.:||.:||||:||:||||
Mouse  1649 LIIQLPSNYPLGSITVESGKRIGVAVQQWRNWMLQLSTYLTHQNGSIMEGLALWKNNVDKRFEGV 1713

  Fly  1695 EECYVCYTVIHQETCQLPKLTCKTCKKKFHGPCLYKWFTTSSKSTCPICRNVF 1747
            |:|.:|::|||.....|||..|:|||||||..|||||||:|:|||||:||..|
Mouse  1714 EDCMICFSVIHGFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF 1766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 15/20 (75%)
Ltn1NP_001074537.1 HEAT 1. {ECO:0000255} 59..96 15/37 (41%)
HEAT 2. {ECO:0000255} 100..138 13/38 (34%)
HEAT 3. {ECO:0000255} 273..314 10/41 (24%)
HEAT 4. {ECO:0000255} 335..372 8/37 (22%)
HEAT 5. {ECO:0000255} 380..418 9/42 (21%)
HEAT 6. {ECO:0000255} 433..473 10/40 (25%)
HEAT 7. {ECO:0000255} 509..547 10/38 (26%)
HEAT 8. {ECO:0000255} 621..658 11/54 (20%)
HEAT 9. {ECO:0000255} 676..714 9/44 (20%)
HEAT 10. {ECO:0000255} 1067..1104 4/37 (11%)
HEAT 11. {ECO:0000255} 1183..1226 6/43 (14%)
HEAT 12. {ECO:0000255} 1315..1353 10/55 (18%)
HEAT 13. {ECO:0000255} 1378..1415 9/42 (21%)
HEAT 14. {ECO:0000255} 1476..1513 12/46 (26%)
zf-RING_2 1714..1763 CDD:290367 24/35 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369932945
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 569 1.000 Inparanoid score I1058
Isobase 1 0.950 0 Normalized mean entropy S6253
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1085104
orthoMCL 1 0.900 OOG5_132362
Panther 1 1.100 LDO PTHR12389
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.