DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and ltn1

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:XP_012812767.1 Gene:ltn1 XenbaseID:XB-GENE-1217544 Length:1779 Species:Xenopus tropicalis

Alignment Length:1915 Identity:503/1916 (26%)
Similarity:856/1916 (45%) Gaps:305/1916 (16%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLGSST---PIFVGF-SAQTDGGGLVPFAPGFASAEQMPD 61
            ||||.||  |||.||:||||.|.||||...:   |.|:|| |:|:|..    :.|....||::  
 Frog     1 MGGKNKQ--RTKGNARPSSSGRAAELLAKESGTIPGFIGFGSSQSDHS----YVPAVQGAEEV-- 57

  Fly    62 SFDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEHT 126
              |:.:....:::||||||:|.:||.||:||...:.::.::|.::.:||.||:.|..::.|.:..
 Frog    58 --DSLVDADFRLVLRKLSKRDAITKLKAMQEFGFMCKEREMETVRGVLPYWPRIYCKISLDLDRR 120

  Fly   127 VREQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVC 191
            |||.||...:.|:.|.||.:||:||.|:..||.::.|||:||||.|..:|...|.  |::..|..
 Frog   121 VREATQQAFEQLILKVKKYLAPHLKSLMGFWLIAQCDTYSPAASSARVAFEAAFP--AHKQPEAL 183

  Fly   192 MHCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSLKLLSFFMGQTAQTEELSQV 256
            ..|:.||:.....:|...|..|||..:::..||.|.||.||:..||..|...:....::|. |.:
 Frog   184 AFCKEEIMNVLLDHLLKETPDTLSDTQAVPIEDRESKYFRVVTCSLLALKRLLCMLPRSEN-SSL 247

  Fly   257 KEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQKTQLTNLCFQFIDDADP 321
            :|....|::..|||.::||...:|::|:||.:..:.|...  ||:..:.::|.......|||:|.
 Frog   248 QERLAHLLSQSKFWKYSKHSTSSIRSAFFELMSALCQCSP--DVLRAEASRLCPAVLLSIDDSDA 310

  Fly   322 VVAPHIWGCVLLLQSNYVDWFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVTQASL 386
            ||.|.:|..||...:...|.:..:|.:|.:||||.|:|:.|....|..|.||||||:|:|....:
 Frog   311 VVCPALWEAVLYTITTIEDCWEHVNAQKGVLPKLWSVLREGGRGLATVIFPNLLPFISRVPTNII 375

  Fly   387 QDLDIYDFYQRFFDDMKLAVTKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQREQKEEEFS 451
            :...  |||..||:.:...::.: ....|.::|..|.:||.|||||.||:....::..:|.::..
 Frog   376 KTPT--DFYSNFFNSLGQGLSSE-RAVASPAECSAIISAYMECLRFAMQENAGEEEENKKVQQIL 437

  Fly   452 FS-----LLDNNVLEPIAWLLKSDSTHVKIFFQHSSALVAFWDRQINNR-LDN--GDLYAKLLNK 508
            .|     |:|:::.:|     |..::  .:|.|....|.: |:::..:: ||:  ..::|.||.:
 Frog   438 ISDQLMPLIDSSLKDP-----KLQNS--PLFSQVEETLYS-WEKKAESQGLDDKLSRIHATLLRE 494

  Fly   509 FWIRIFELVTQDLSAEEVNEQLLGHVLLLVQDLHMANPSL-----ESPSVKFVEGPNEKIEKSEP 568
            ||..:..:....:...|..|:.|..|..|:|.|...|..|     :...::|   ..|..::|:.
 Frog   495 FWENLAHICVSHVDVIEAGEKNLAGVSGLLQVLQNPNCLLKVNKKKKAKIRF---KGEDDDESDA 556

  Fly   569 TTPVKKAQEAAAFI-----------------QKELKQLVIKLVRICLDKANKGSGSGTSSSRYIE 616
            .:.|.::|..:.||                 |:.|:.||.||..:.:...     |...|.:::.
 Frog   557 VSHVSESQPMSKFIMETCSSSGRDPGIAQLRQERLEDLVCKLAELSMVYI-----SEQRSQQHLM 616

  Fly   617 QIRTLTKMFNDAAFYKSLTDDGDLASALN----------------------KFVSLLGQLSCQAC 659
            .:..|...|.....::.|..........|                      |.:......|.:..
 Frog   617 FLAALLSTFPSIRVFQVLLQQSSEEDPKNLNSPDHDVTPRHKNPAVQFLYAKLIFWFNDKSLEES 681

  Fly   660 ESVVEIVFEIL----------PLLETGKRFEYIENTLMKLPQHGVQN--------------LLLH 700
            :.:|:|::.:|          .||:...:..:..:..:.:.|....:              :|..
 Frog   682 DFLVDILYSVLFCCTDSSERKHLLDDMTKMNFKWSVFLYIIQKACTDPEKYSLASDWLKGEVLGE 746

  Fly   701 RL--LSYPLCAEAAVRQMLSGPETCE----MIARIAEE------VVVDNDREK-LNLLHKCFFQT 752
            ||  |:..||....:.:.......|.    :::.:..|      ::.|...|| :|.||..    
 Frog   747 RLICLANDLCTSGLMDKATPSEAYCSKKWALLSLVLSEHVHNEYLIADAYVEKIINKLHSA---- 807

  Fly   753 DTGDILINAKTVDKILLSMCGPLEQPVVDDAVEVCGSFIAQIMPVICSNNNSSLHV--RQHIFLK 815
                 |:.|:.     ||..|.|||.|         |||..:.....|:....|.:  .:.:.|.
 Frog   808 -----LMKARN-----LSKAGHLEQSV---------SFICDVGSNFFSSIKGCLQMPSAEDLLLT 853

  Fly   816 LFKFSLEHRPEDYLSEDTLWEITTCWQDGLSS-----KDIEIDDDMLKCCAGIVEELANSAELKA 875
            :|:...:.....::||..|.::...|..||.|     |::....:.||..|..|::...::.|..
 Frog   854 IFQLCAQASDTSHMSESLLLKLKNTWLAGLHSLVCQYKNMPQGSNFLKQSAQWVKDQIQTSHLNV 918

  Fly   876 DTLDGMAEAMAKFVICSTENIEDEYKRLERIDETLTALLETPLKTTDKVQQFENHCVLLEALHGS 940
            .:|..:        ||:   ::|.|..:  :|.:|:........|...:...|....:..||   
 Frog   919 KSLQSL--------ICT---VDDLYSTI--LDSSLSGFSLLAEHTASMMPSAETWQKMRHAL--- 967

  Fly   941 VTAGVPFENACLSRNEILPLLQ-RSTLNFSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNADVLK 1004
                   .:..||:    |||: |.::|..|....:..|        |:..|....|  .|.:|.
 Frog   968 -------SSQWLSK----PLLEGRLSMNTETSGTDLKSF--------PKTWLPSHLC--TASLLS 1011

  Fly  1005 KWNEPLIAELLQCIRVAGTAECWLEMSVLQSS-------TEELVLILSEKVQSFMGNSSDL---V 1059
            |    :...||:..:.....|..:::::..:.       .|||     ||..:.:|...::   :
 Frog  1012 K----MALRLLEKEKSLKEEEIGVKINITVAEMLYSLQWCEEL-----EKPPTLIGECCEMLCSL 1067

  Fly  1060 AIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASILLHE---------DLSENL----- 1110
            .:..|::...:|....:::   |.|.|.....:.:..:|:..:|:         .|:|:.     
 Frog  1068 GVSHEKVMDLSVHLPGLLE---LLYNRSKEDGSLWSLTANRFIHKRGAGPSELLPLTEDTEKYFP 1129

  Fly  1111 VTQGALKTYVIALQFLLPKLSQKAI--------TLS-SAIMGTEPPEIWVKAAVFHALLLNNFEG 1166
            ||.|:|.|......|:.|:|.::.:        |.| ||:..|:       ....:..::|:..|
 Frog  1130 VTLGSLHTIQSLSAFMCPELKEELVIQCTARLMTCSASAVSCTD-------GGFGYLAIINSCLG 1187

  Fly  1167 DVNEQTDRNIIVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYESVINTVEFIKLLTEVLKRFPY 1231
            . :....:.|:...::.|.|..:   .|:|:..::..:|......:...||.|:.|:.:||....
 Frog  1188 S-DSDLCQEILPGVLKVMLSWKD---DQEDIFLFSSNVQDSSQSLIGLNVEMIRFLSILLKYLAS 1248

  Fly  1232 ELSI---KNWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALIDFIRSEKQKSSTEL 1293
            .:|.   .:||.|...:.:|:.|..:|.|.|..|...||..|..:|...:..:..|....::..|
 Frog  1249 SVSSLVDVDWDFIMCSMLAWLESACESSAAYHIPLVRLFACASCDLATEISHYFESVATSTTMSL 1313

  Fly  1294 LKNMIDEWDSLFAKEVNLVLFKSYYLLTHEVSVDPGFQACYEALLEQITPVIER----------L 1348
            ..|::.||...|::.:..::......:..|      ::|...:.:..:...:.|          |
 Frog  1314 PANLMSEWKEFFSEGIYSLMLPMLVRIAEE------YKASETSHMSHVLKSLGRTLGYISKEQLL 1372

  Fly  1349 DYSFVYSFC---KSNSNITLDHLCNFLFKQLYSVQHSVRLSAVHSLRQL---TPHFVADDIELNE 1407
            ::.....|.   |:|...:|..|.|.|...|...:.||:::..|.|.::   .|.|..:|::...
 Frog  1373 NHKLPAKFVAGQKTNLTDSLQSLLNTLAPLLLYRERSVQITVYHLLDKIMADLPGFDDEDLKSYG 1437

  Fly  1408 KQSESLDASTTICKWHFLNRFEDYLTRYDALITKYLEEFTFKLSELDDLEPIDRH--NALSYLFL 1470
            .:.|....|........|...||       |:...|:|  ..:.|...:||:...  ..|.||..
 Frog  1438 DEDEEPALSPPAALMSVLAIQED-------LVESILKE--IPVGEFAVIEPLKEEFCFVLGYLLT 1493

  Fly  1471 WDCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRAMPVD-ILKNHGAKVHSNG-------- 1526
            |..|:.....:...|||:|:.:|...|.....|:.||:.||.: :|....:.:.|..        
 Frog  1494 WKLILTFFKAASSQLRALYSQYLRKTKSLNKLLYNLFKLMPHNPVLPGQASDMPSKEPKTFFTEE 1558

  Fly  1527 ---VYKELTWSQQKDRHLPLERYACHLYTEVLRKLPAVVRRWWNATQSRQKNFIDNLTTNYVSSL 1588
               ..|.....||:..||     ||.:|...|:.|||:||.|||..:.|..|.:|..||.||||:
 Frog  1559 LQLAVKGTATVQQEVPHL-----ACCVYHMTLKDLPAMVRLWWNGCEKRIFNVVDRFTTKYVSSV 1618

  Fly  1589 ICSEELKAIANRKEKHENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPLGAVKVECGKQIG 1653
            :.|:|:.::....:..:.|.|...|:||||:|.|::|:..:||:|.|..|||||::.||.|:::|
 Frog  1619 LSSQEISSVQLSTQVFDGMTVKARSTTREVIATYSVDDICIELIIQLPQNYPLGSITVESGRRVG 1683

  Fly  1654 GRASS-RNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIHQETCQLPKLTCK 1717
            ..... ||..:||..:||||||:|.:||.:||||:||:|||||:|.:|::|||.....|||..|:
 Frog  1684 VAVQQWRNWMLQLNTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGSNYSLPKKACR 1748

  Fly  1718 TCKKKFHGPCLYKWFTTSSKSTCPICRNVF 1747
            |||||||..|||||||:|:|||||:||..|
 Frog  1749 TCKKKFHSECLYKWFTSSNKSTCPLCRETF 1778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 15/20 (75%)
ltn1XP_012812767.1 zf-RING_2 1726..1775 CDD:290367 31/49 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369929226
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 481 1.000 Inparanoid score I1340
OMA 1 1.010
OrthoDB 1 1.010 D19753at2759
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1061055
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 1 0.960
109.890

Return to query results.
Submit another query.