DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and Ltn1

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_001019406.2 Gene:Ltn1 RGDID:1311238 Length:1767 Species:Rattus norvegicus

Alignment Length:1927 Identity:516/1928 (27%)
Similarity:850/1928 (44%) Gaps:341/1928 (18%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLG---SSTPIFVGFSAQTDGGGLVPFAPGFASAEQMPDS 62
            ||||.||  |||.|.:||:|.|.||||.   .:.|.|:||.......|.||       |.|..:.
  Rat     1 MGGKNKQ--RTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSHSDLGYVP-------AIQGAED 56

  Fly    63 FDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEHTV 127
            .|:.:....:::||||||||..||.||:||...:..:.|.|.:|.:||.||:.:..::.|.:..|
  Rat    57 IDSLVDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTEAVKGVLPYWPRIFCKISLDHDRRV 121

  Fly   128 REQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVCM 192
            ||.||...:.|:.|.||.:|||||.::..||.::.|||.|||:.|..:|...|.  .::..|..:
  Rat   122 REATQQAFEKLILKVKKHLAPYLKSVMGYWLMAQCDTYPPAATAAKDAFEAAFP--PSKQPEAIV 184

  Fly   193 HCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSL----KLLSFFMGQTAQTEEL 253
            .|:.||......:|...|..|||..:::..|:.|.|:.||:..||    :||.|.     ...||
  Rat   185 FCKEEITTVLQDHLLKETPDTLSDPQTVPEEEREAKFHRVVTCSLLALKRLLCFL-----PNNEL 244

  Fly   254 SQVKEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQKTQLTNLCFQFIDD 318
            ..::|.|.:|::..|||.:.||.||.:::|:||.:..:.|.|.  .|:..:..:::......|||
  Rat   245 DSLEEKFRSLLSQNKFWKYGKHSVPQVRSAYFELVSALCQHVP--QVMKEEAAKVSPSVLLSIDD 307

  Fly   319 ADPVVAPHIWGCVLLLQSNYVDWFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVTQ 383
            :||||.|.:|..||...:...|.:..:|.:|::.|||::::::|....|..|.|.||||:||:.|
  Rat   308 SDPVVCPALWEAVLYTLTTVEDCWFHVNAKKSVFPKLTAMIRDGGRGLAAVIYPYLLPFISKLPQ 372

  Fly   384 ASLQDLDIYDFYQRFFDDMKLAVTKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQREQKEE 448
            :..:..  .||::.|...:...::.: ....|.::|..:..|:||||||:|||       ...||
  Rat   373 SITEPK--LDFFKNFLTSLVTGLSTE-RTRSSSAECSAVIAAFFECLRFIMQQ-------NLGEE 427

  Fly   449 EFSFSLLDNNVLEPIAWLLKSDSTHVKIFFQHSSALVAFWDRQINNRLDNGDLY--AKLLNKFWI 511
            |....|:...::..|..:||.........|.|.:..::.|:.:.:...|...:|  .|:|..||.
  Rat   428 EMVQMLIGEQLIPFIDIVLKDSGLQHGPLFNHLADTLSSWEAKADVEQDAETVYNLEKVLLSFWE 492

  Fly   512 RIFELVTQDLSAEEVNEQLLGHVLLLVQDLHMANPSLES-----PSVKFV----EGP--NEKIEK 565
            |:.|:..:.:|..|.:.:.:..|..||..|.....||:|     ..|:||    |.|  :||...
  Rat   493 RLSEICIEKISEPEADVKSVLGVSNLVGILQKPESSLKSNRKRNGKVRFVIDTPEAPKGSEKCVS 557

  Fly   566 SE-------------PTTPVKKAQEAAAFIQKELKQLVIKLVRICLDKANKGSGSGTSSSRYIEQ 617
            ||             .:...|.:...:...:|.|:.||.||..:.:...|:     ..|.::::.
  Rat   558 SEGENSEGSEGGGTGSSLSYKSSDVVSPLRKKPLEDLVCKLAEVSISFVNE-----QKSEQHLQF 617

  Fly   618 IRTLTKMFNDAAFYKSLTDDG----------DLASALNK-------FVSLLGQLSCQACES---V 662
            :.||...|:....:|.|..|.          ::.....|       :..|:|.|:....|.   :
  Rat   618 LSTLLDSFSSGQVFKILLGDKQKNIVKAKPLEITKLAEKNPAVQFLYHKLIGWLNDSQKEDGGFL 682

  Fly   663 VEIVFEILPLLETG-KRFEYIENTLMKLPQHGVQNLLLHRLLSYPLCA----EAAVRQMLSGPET 722
            |:|::..|...::. :|.|.:::    |.|..::...|.|::. ..|:    .|.|...|.|...
  Rat   683 VDILYSALRCCDSDVERKEVLDD----LTQEDLKWSSLLRVIE-KACSSSDKHALVTPWLKGSIL 742

  Fly   723 CEMIARIAE-------EVVVDND---REKLNLLHKCFFQTDTGDILINAKTVDKILLSMCGPL-- 775
            .|.:..:|:       |..:.::   .|:..||.....|....|.||....|.:|::.:...|  
  Rat   743 GEKLVALADCLCGKDLESTISSECHSSEQWTLLRLALSQHLKNDYLIGEVYVARIIVKLHETLSK 807

  Fly   776 -----EQPVVDDAVEVCGSFIAQIMPVICSNNNSSL--HVRQHIFLKLFKFSLEHRPEDYLSEDT 833
                 |....|.:|    ||:..::....|:....|  ...:.:.|.||:...:.:...:|.:..
  Rat   808 TKDFSEAADSDSSV----SFVCDVIHSFFSSAGGGLLTPASEDLLLTLFQLCAQSKERTHLPDFL 868

  Fly   834 LWEITTCWQDGLSSKDIEIDDDMLKCCAGIVEELANSAELKADTLDGMAEAMAKFVICSTENIED 898
            :.::......|::.               :|.:.|::.|            .:.|:..|...::|
  Rat   869 ICKLKNTLLSGVNL---------------LVHQTASTYE------------QSTFLRLSVLWLKD 906

  Fly   899 EYKRLERIDETLTALLETPLKTTDKVQQFENHCVLLEALHGSVTAGVPFENACLSRNEIL----- 958
            :.:.....:|:|..||.........:.:.|: ..||....|||   :|.::......:.|     
  Rat   907 QVQSSVLDNESLQVLLSAVGDLLSTLVESED-TSLLGVYIGSV---MPSDSEWEKMRQSLPVQWL 967

  Fly   959 --PLLQ-RSTLN---FSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNA----------------- 1000
              |||: |.:||   |.|.:|       .|||.    .|....|..:.                 
  Rat   968 HRPLLEGRLSLNYECFKTDFK-------DQDTK----TLPNHLCTSSLLSKMILIAQKKEIVLEN 1021

  Fly  1001 DVLKKWNEPLIAELLQCIR-----------VAGTAECWLEMSVLQSSTEELVLILSEKVQSFMGN 1054
            |||:|    :.||||..::           ::|..|...:|::..|:.            |.:||
  Rat  1022 DVLEK----ICAELLYSLQWCEELDNPPSFLSGFCEMLQKMNITYSNL------------SVLGN 1070

  Fly  1055 SSDLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASILLHEDLSENLV-------- 1111
            :|.|:.::.:|.::.....|.:|                    |.::|...:|.:.|        
  Rat  1071 TSSLLQLLFDRSRKNGTLWSLII--------------------AKLILSRSISSDEVKPYYKRKE 1115

  Fly  1112 -----TQGALKTYVIALQFLLPKLSQK-----AITLSSAIMGTEPPEIWVK------------AA 1154
                 |:|.|.|    :|.|.|.||::     :.....|.:|      |.|            .|
  Rat  1116 SFFPLTEGNLHT----IQSLCPFLSKEEKKEFSAQCIPAFLG------WTKEDLCSINGAFGHLA 1170

  Fly  1155 VFHALLLNNFEGDVNEQT----DRNIIVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYESVINT 1215
            :|::.|          ||    |:.::...::.:||   .:...:|:..::..:.....|.:...
  Rat  1171 IFNSCL----------QTRSIDDKQLLHGILKIITS---WRKQHEDIFLFSCNLSEASPEVLGLN 1222

  Fly  1216 VEFIKLLTEVLKRFPYELSIKNWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALID 1280
            :|.::.|:..||...|.|:...||.|...:.:|:.:.|::.|.|..|...||....::|...|..
  Rat  1223 IEIMRFLSLFLKYCSYPLAESEWDFIMCSMLAWLETASENQALYCVPLVQLFACVSFDLACDLSA 1287

  Fly  1281 FIRSEKQKSSTELLKNMIDEWDSLFAKEVNLVLFKSYYLLTHEVSVD-----PGFQACYEALLEQ 1340
            |..|....:...|..|:|.||...|:|.::.:|..   ||.:....|     ..||   .|:|: 
  Rat  1288 FFDSITPDTVDNLPVNLISEWKEFFSKGIHGLLLP---LLVNATGEDKDLSETSFQ---NAVLK- 1345

  Fly  1341 ITPVIERLDY------------SFVYSFCKSNSNITLDHLCNFLFKQLYSVQHSVRLSAVHSLRQ 1393
              |:.|.|.|            ..:.:..|:|....|..|.|.|...|......|:::|.|.|.:
  Rat  1346 --PMCETLTYISKDQLLSHKLPKRLVASQKTNLPEHLQTLLNTLTPLLLFRARPVQIAAYHMLYK 1408

  Fly  1394 L---TPHFVADDIELNEKQSESLDASTTICKWHFLNRFEDYLTRYDALITKYLEEFTFKLSELDD 1455
            |   .|....|:::....:.|....|........|:..|:.|......:         .:.::..
  Rat  1409 LMAELPQHDQDNLKSYGDEEEEPALSPPAALMSLLSTQEELLENVLGCV---------PVGQIVP 1464

  Fly  1456 LEPI--DRHNALSYLFLWDCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRAMPVDILKNH 1518
            ::|:  |....|.||..|..|:.....:...|||:|:.:|...|.....|:.|||.||.:.....
  Rat  1465 IKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLYHLFRLMPENPTYGE 1529

  Fly  1519 GAKVHSNGVYK-----ELTWSQQKDRHLP--LERYACHLYTEVLRKLPAVVRRWWNATQSRQKNF 1576
            .|...||...|     ||..|.::...||  :...||.:|...|:.|||:||.|||:::.|..|.
  Rat  1530 TAIEVSNKDPKTFFTEELQLSIRETATLPYHIPHLACSVYHMTLKDLPAMVRLWWNSSEKRVFNI 1594

  Fly  1577 IDNLTTNYVSSLICSEELKAIANRKEKHENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPL 1641
            :|..|:.||||::..:|:.::....:....|.|...::||||:|.|.|::..:||:|.|..||||
  Rat  1595 VDRFTSKYVSSVLSFQEISSVQTSTQLFNGMTVKARATTREVMATYTIEDIVIELIIQLPSNYPL 1659

  Fly  1642 GAVKVECGKQIGGRASS-RNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIH 1705
            |::.||.||::|..... ||..:||:.:||||||:|.|||.:||||:||:|||||:|.:|::|||
  Rat  1660 GSITVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSIMDGLALWKNNVDKRFEGVEDCMICFSVIH 1724

  Fly  1706 QETCQLPKLTCKTCKKKFHGPCLYKWFTTSSKSTCPICRNVF 1747
            .....|||..|:|||||||..|||||||:|:|||||:||..|
  Rat  1725 GFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF 1766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 15/20 (75%)
Ltn1NP_001019406.2 zf-RING_2 1714..1763 CDD:290367 24/35 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369935520
eggNOG 1 0.900 E1_COG5219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D19753at2759
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132362
Panther 1 1.100 LDO PTHR12389
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.810

Return to query results.
Submit another query.