DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and LTN1

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_056380.3 Gene:LTN1 HGNCID:13082 Length:1766 Species:Homo sapiens

Alignment Length:1927 Identity:516/1928 (27%)
Similarity:853/1928 (44%) Gaps:342/1928 (18%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLG---SSTPIFVGF-SAQTDGGGLVPFAPGFASAEQMPD 61
            ||||.||  |||.|.:||:|.|.||||.   .:.|.|:|| ::|:|.|    :.|....||::  
Human     1 MGGKNKQ--RTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLG----YVPAIQGAEEI-- 57

  Fly    62 SFDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEHT 126
              |:.:....:::||||||||..||.||:||...:..:.|.|.:|.:||.||:.:..::.|.:..
Human    58 --DSLVDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRR 120

  Fly   127 VREQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVC 191
            |||.||...:.|:.|.||.:|||||.|:..||.::.|||.|||..|..:|...|.  .::..|..
Human   121 VREATQQAFEKLILKVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFP--PSKQPEAI 183

  Fly   192 MHCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSL----KLLSFFMGQTAQTEE 252
            ..|:.||......:|...|..|||..:::..|:.|.|:.||:..||    :||...     ...|
Human   184 AFCKDEITSVLQDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKRLLCLL-----PDNE 243

  Fly   253 LSQVKEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQKTQLTNLCFQFID 317
            |..::|.|.:|::..|||.:.||.||.|::|:||.:..:.|.:..|  :..:.::::......||
Human   244 LDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQL--MKEEASKVSPSVLLSID 306

  Fly   318 DADPVVAPHIWGCVLLLQSNYVDWFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVT 382
            |:||:|.|.:|..||...:...|.::.:|.:|::.||||::::.|....|..|.|.||||:||:.
Human   307 DSDPIVCPALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIREGGRGLATVIYPYLLPFISKLP 371

  Fly   383 QASLQDLDIYDFYQRFFDDMKLAVTKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQREQKE 447
            | |:.:..: ||::.|...:...::.:.....|.....|| :|:||||||:|||       ...|
Human   372 Q-SITNPKL-DFFKNFLTSLVAGLSTERTKTSSLESSAVI-SAFFECLRFIMQQ-------NLGE 426

  Fly   448 EEFSFSLLDNNVLEPIAWLLKSDSTHVKIFFQHSSALVAFWDRQINNRLDNGDLY--AKLLNKFW 510
            ||....|:::.::..|..:||.........|.|.:..::.|:.:.:...|....:  ..:|..||
Human   427 EEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTAHNLENVLIHFW 491

  Fly   511 IRIFELVTQDLSAEEVN-EQLLGHVLLLVQDLHMANPSLESP-----SVKF-------------- 555
            .|:.|:....:|..|.: |.:|| |..|:|.|.....||:|.     .|:|              
Human   492 ERLSEICVAKISEPEADVESVLG-VSNLLQVLQKPKSSLKSSKKKNGKVRFADEILESNKENEKC 555

  Fly   556 VEGPNEKIEKSEPTTPVKKAQEAAAFI----QKELKQLVIKLVRICLDKANKGSGSGTSSSRYIE 616
            |....||||..|.||.......::..:    :|.|:.||.||..|.::..|:     ..|.:::.
Human   556 VSSEGEKIEGWELTTEPSLTHNSSGLLSPLRKKPLEDLVCKLADISINYVNE-----RKSEQHLR 615

  Fly   617 QIRTLTKMFNDAAFYKSLTDDG----------DLASALNK-------FVSLLGQLSCQACES--- 661
            .:.||...|:.:..:|.|..|.          ::|..:.|       :..|:|.|:....:.   
Human   616 FLSTLLDSFSSSRVFKMLLGDEKQSIVQAKPLEIAKLVQKNPAVQFLYQKLIGWLNEDQRKDFGF 680

  Fly   662 VVEIVFEIL----------PLLETGKRFEYIENTLMKLPQHGVQNLLLHRLLSYPLCAEAAVRQM 716
            :|:|::..|          .:|:...:.:...|:|:|:.:....:...|.|:: |......:.:.
Human   681 LVDILYSALRCCDNDMERKKVLDDLTKVDLKWNSLLKIIEKACPSSDKHALVT-PWLKGDILGEK 744

  Fly   717 LSGPETC----EMIARIAEEVVVDNDREKLNLLHKCFFQTDTGDILINAKTVDKILLSMCGPL-- 775
            |.....|    ::.:|::.|   .:..|:..||.....|....|.||....|::|::.:...|  
Human   745 LVNLADCLCNEDLESRVSSE---SHFSERWTLLSLVLSQHVKNDYLIGDVYVERIIVRLHETLFK 806

  Fly   776 -----EQPVVDDAVEVCGSFIAQIMPVICSNNNSSLHV--RQHIFLKLFKFSLEHRPEDYLSEDT 833
                 |....|.:|    |||..:.....|:....|.:  .:.:.|.||:...:.:.:.:|.:..
Human   807 TKKLSEAESSDSSV----SFICDVAYNYFSSAKGCLLMPSSEDLLLTLFQLCAQSKEKTHLPDFL 867

  Fly   834 LWEITTCWQDGLSSKDIEIDDDMLKCCAGIVEELANSAELKADTLDGMAEAMAKFVICSTENIED 898
            :.::...|..|::....:.|....:.....:..|....:::|.:||                |..
Human   868 ICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSALWLKNQVQASSLD----------------INS 916

  Fly   899 EYKRLERIDETLTALLETPLKTTDKVQQFENHCVLLEALHGSVTAGVPFENACLSRNEIL----- 958
            ....|..:|:.|..|||:            ....|:....|||   :|.::......:.|     
Human   917 LQVLLSAVDDLLNTLLES------------EDSYLMGVYIGSV---MPNDSEWEKMRQSLPMQWL 966

  Fly   959 --PLLQ-RSTLN---FSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNADVLKKW----------- 1006
              |||: |.:||   |.|.:|       .||..    .|....|  .:.:|.|.           
Human   967 HRPLLEGRLSLNYECFKTDFK-------EQDIK----TLPSHLC--TSALLSKMVLIALRKETVL 1018

  Fly  1007 ----NEPLIAELLQCIR-----------VAGTAECWLEMSVLQSSTEELVLILSEKVQSFMGNSS 1056
                .|.:|||||..::           :.|..|...:|::...:...|            ||:|
Human  1019 ENNELEKIIAELLYSLQWCEELDNPPIFLIGFCEILQKMNITYDNLRVL------------GNTS 1071

  Fly  1057 DLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASILLHEDLSENLV---------- 1111
            .|:.::..|.::.....|.:|                    |.::|...:|.:.|          
Human  1072 GLLQLLFNRSREHGTLWSLII--------------------AKLILSRSISSDEVKPHYKRKESF 1116

  Fly  1112 ---TQGALKTYVIALQFLLPKLSQK-----AITLSSAIMGTEPPEIWVK------------AAVF 1156
               |:|.|.|    :|.|.|.||::     :.....|::|      |.|            .|:|
Human  1117 FPLTEGNLHT----IQSLCPFLSKEEKKEFSAQCIPALLG------WTKKDLCSTNGGFGHLAIF 1171

  Fly  1157 HALLLNNFEGDVNEQT----DRNIIVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYESVINTVE 1217
            ::.|          ||    |..::...::.:.|   .:...:|:..::..:.....|.:...:|
Human  1172 NSCL----------QTKSIDDGELLHGILKIIIS---WKKEHEDIFLFSCNLSEASPEVLGVNIE 1223

  Fly  1218 FIKLLTEVLKRFPYELSIKNWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALIDFI 1282
            .|:.|:..||.....|:...||.|...:.:|:.:.|::.|.|..|...||.....:|...|..|.
Human  1224 IIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSENQALYSIPLVQLFACVSCDLACDLSAFF 1288

  Fly  1283 RSEKQKSSTELLKNMIDEWDSLFAKEVNLVLFKSYYLLTHE---VSVDPGFQACYEALLEQITPV 1344
            .|....:...|..|:|.||...|::.::.:|......:|.|   || :..||   .|:|:   |:
Human  1289 DSTTLDTIGNLPVNLISEWKEFFSQGIHSLLLPILVTVTGENKDVS-ETSFQ---NAMLK---PM 1346

  Fly  1345 IERLDY------------SFVYSFCKSNSNITLDHLCNFLFKQLYSVQHSVRLSAVHSLRQL--- 1394
            .|.|.|            :.:.:..|:|....|..|.|.|...|......|:::..|.|.:|   
Human  1347 CETLTYISKEQLLSHKLPARLVADQKTNLPEYLQTLLNTLAPLLLFRARPVQIAVYHMLYKLMPE 1411

  Fly  1395 TPHFVADDIELNEKQSESLDASTTICKWHFLNRFEDYLTRYDALITKYLEEFTFKLSELDDLEPI 1459
            .|.:..|:::....:.|....|........|:..||.|......|         .:.::..::|:
Human  1412 LPQYDQDNLKSYGDEEEEPALSPPAALMSLLSIQEDLLENVLGCI---------PVGQIVTIKPL 1467

  Fly  1460 --DRHNALSYLFLWDCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRAMP---------VD 1513
              |....|.||..|..|:.....:...|||:|:.:|...|.....|:.|||.||         |:
Human  1468 SEDFCYVLGYLLTWKLILTFFKAASSQLRALYSMYLRKTKSLNKLLYHLFRLMPENPTYAETAVE 1532

  Fly  1514 ILKNHGAKVHSNGVYKELTWSQQKDRHLP--LERYACHLYTEVLRKLPAVVRRWWNATQSRQKNF 1576
            : .|...|....   :||..|.::...||  :...||.:|...|:.|||:||.|||:::.|..|.
Human  1533 V-PNKDPKTFFT---EELQLSIRETTMLPYHIPHLACSVYHMTLKDLPAMVRLWWNSSEKRVFNI 1593

  Fly  1577 IDNLTTNYVSSLICSEELKAIANRKEKHENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPL 1641
            :|..|:.||||::..:|:.::....:....|.|...::||||:|.|.|::..:||:|.|..||||
Human  1594 VDRFTSKYVSSVLSFQEISSVQTSTQLFNGMTVKARATTREVMATYTIEDIVIELIIQLPSNYPL 1658

  Fly  1642 GAVKVECGKQIGGRASS-RNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIH 1705
            |::.||.||::|..... ||..:||:.:||||||:|.:||.:||||:||:|||||:|.:|::|||
Human  1659 GSIIVESGKRVGVAVQQWRNWMLQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIH 1723

  Fly  1706 QETCQLPKLTCKTCKKKFHGPCLYKWFTTSSKSTCPICRNVF 1747
            .....|||..|:|||||||..|||||||:|:|||||:||..|
Human  1724 GFNYSLPKKACRTCKKKFHSACLYKWFTSSNKSTCPLCRETF 1765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 15/20 (75%)
LTN1NP_056380.3 COG5219 59..>262 CDD:227544 74/210 (35%)
HEAT 1. {ECO:0000255} 59..96 15/37 (41%)
HEAT 2. {ECO:0000255} 100..138 14/38 (37%)
HEAT 3. {ECO:0000255} 273..314 11/43 (26%)
HEAT 4. {ECO:0000255} 335..372 16/37 (43%)
HEAT 5. {ECO:0000255} 380..418 12/39 (31%)
HEAT 6. {ECO:0000255} 433..473 7/40 (18%)
HEAT 7. {ECO:0000255} 513..551 11/39 (28%)
HEAT 8. {ECO:0000255} 611..658 8/47 (17%)
HEAT 9. {ECO:0000255} 676..714 5/38 (13%)
HEAT 10. {ECO:0000255} 768..810 10/42 (24%)
HEAT 11. {ECO:0000255} 911..949 13/69 (19%)
HEAT 12. {ECO:0000255} 1068..1105 10/57 (18%)
HEAT 13. {ECO:0000255} 1184..1227 5/46 (11%)
HEAT 14. {ECO:0000255} 1314..1352 12/45 (27%)
HEAT 15. {ECO:0000255} 1377..1414 10/37 (27%)
HEAT 16. {ECO:0000255} 1475..1512 11/37 (30%)
COG5219 <1477..1765 CDD:227544 123/292 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369931359
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 541 1.000 Inparanoid score I1170
Isobase 1 0.950 0 Normalized mean entropy S6253
OMA 1 1.010
OrthoDB 1 1.010 D19753at2759
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1075000
orthoMCL 1 0.900 OOG5_132362
Panther 1 1.100 LDO PTHR12389
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.