DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and SPBC21D10.09c

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_596004.1 Gene:SPBC21D10.09c PomBaseID:SPBC21D10.09c Length:1610 Species:Schizosaccharomyces pombe

Alignment Length:1929 Identity:422/1930 (22%)
Similarity:733/1930 (38%) Gaps:528/1930 (27%)


  Fly    22 RTAELLGSSTPIFVGFSAQTDGGGLVPFA-----PGFASAEQMPDSFDAAISPQTQIILRKLSKK 81
            ::.:|.|...|   |..:.:.....:..|     ..|::..:.||.  :.:..:..:|::.|.|:
pombe     4 KSTDLYGRKNP---GMQSMSGSFSSLQIALDESSSNFSTIYEPPDL--SGLDAEMIVIVKNLQKR 63

  Fly    82 DPMTKKKALQELHELIE--QSDVEVLKNILP-LWPKYYLNLASDPEHTVREQTQTVLQLLMAKCK 143
            |.:||.:|||:|.:..:  |.|.|...|.|. |:|:    |:.:.|..||.:....:.:|.:..:
pombe    64 DIVTKCRALQDLIQWNDPSQFDNEQFLNALAVLFPR----LSIEVERHVRLKIFVFMSVLSSALQ 124

  Fly   144 KAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVCMHCQVE----ILEYATR 204
            |.:||:||..:..|:...||:....:..|..||::..      |.|...|..::    |....|.
pombe   125 KKLAPWLKFYITPWVMGFFDSDRAVSVSAKDSFKNLL------SEEKWPHVWLKFGSTIAPIVTD 183

  Fly   205 NLTFHTAATLSIGKSLTPEDAEQKYQRVIISSLKLLSFFMGQTAQTEEL------------SQVK 257
            ........:|:..:..:.|:||.|..||..|.|..|||...|||..|.|            |.:.
pombe   184 VFLHEDKESLTDLRFFSNEEAESKVTRVKSSCLLTLSFLFKQTADLENLETDKKIDKQTFKSSLY 248

  Fly   258 EGFGTLVAHQKFWSFA-------------------KHKVPAI---KAAWFECIYHILQSVALLDV 300
            |...||....:|||..                   |:..|.:   |..:|:.:..::..:..|..
pombe   249 ENLSTLFKSDEFWSLVSSPQDGVTVSLSDLLLIILKYDKPFVTQYKEKYFKRVSRMISRLTSLTC 313

  Fly   301 ITPQKTQLTNLCFQFIDDADPVVAPHIWGCVLLLQSNYVDWFV-----PLN-IRKTLLPKLSSLL 359
            : |....|:|:...|                    .|.|..|.     ||: :...|:.|..||.
pombe   314 V-PMLRLLSNMISNF--------------------PNEVHQFANDSKRPLSKLFSNLITKRISLP 357

  Fly   360 QNGF-----NRNAQAICPNLLPFLSKVTQASLQDLDIYDFYQRFFDDMKLAVTKKFDPPLSKSDC 419
            .:||     |.........|:|.:..|.:.....|:..:..|||..      |:.:       ||
pombe   358 NSGFYTSLLNLFKSIGAMQLVPSIESVDELCDAFLETANQEQRFLS------TEVY-------DC 409

  Fly   420 IVIHNAYFECLRFLMQQINNNKQREQKEEEFSFSLLDNN---VLEPIAWLLKSDSTHVKIFFQHS 481
            :         |.||                 ||...|::   :.:.:...|::..|.   :|:..
pombe   410 L---------LNFL-----------------SFVYTDSSDPQIKDHVRDRLRTIFTR---YFKGE 445

  Fly   482 SAL---VAFWDRQINNRLDNGDLYAKLLNKFWIRIFELVTQDLSAEEVNEQLLGHVLLLVQD-LH 542
            ..|   .:.:|..:.:..|....:|.|.|:.....|...:.|:..... :.|..::.|.||. |:
pombe   446 FVLRCSTSDFDHCLQSVFDKNSDFASLWNEVLFGFFNDESMDIETIPF-DSLSRNLSLTVQTVLY 509

  Fly   543 MANPSLESPS-VKFVEGPNEKIEKSEPTTPVKKAQEAAAFIQKELKQLVIKLVRI-CLDKANKGS 605
            :.|.:.::.: |..:.||                  ..:|:   :|....|..|| ||..:    
pombe   510 LKNRNFQTGNEVMSILGP------------------CLSFL---MKLSTHKNERIACLSAS---- 549

  Fly   606 GSGTSSSRYIEQIRTLTKMFNDAAFYKSLTD------DGDLASALNKFVSLLGQLSCQACESVVE 664
                       |:.|:..:|:|....|.:.:      ..||.|::.|    ||..|     ....
pombe   550 -----------QLITVCHIFSDTTLIKPVKELFQKYLVNDLPSSILK----LGPQS-----PAFT 594

  Fly   665 IVFEILPLLETGKRFEYIENTLMKLPQHGVQNLL---------LHRLLSYP-LCAEAAVRQMLSG 719
            ::.:||.||:     :|.:   :..|...|.|..         :..|.|.| |.|:..:|..:|.
pombe   595 LLRDILLLLK-----DYAD---LSEPWENVANQFTVSFDELENIRVLNSLPSLFADGKLRGKISL 651

  Fly   720 PETCEMIARIAEEVVVDNDREKLNLLHKCFFQTDTGDILINAKTVDKILLSMCGPLEQPVVDDAV 784
            .:|.......|...::.|.....:::..|.   .:.:||:..:|:..||.:   .||..:.:|.|
pombe   652 VKTLVEYYDTAVFAIMQNPGNDWDMIRACI---GSKEILVPEETIKNILFT---TLEYFLTNDWV 710

  Fly   785 E-----VCGSF--IAQIMPVICSNNNSSLHVRQHIFLKLFKFSLEHRPEDYLSEDTLWEITTCWQ 842
            :     :|.|.  :...:|.|...|.|     .:..|.:..||   :|||               
pombe   711 DNHLIILCASLHSLKAHLPTIFDENKS-----LYSLLPVILFS---KPED--------------- 752

  Fly   843 DG------------LSSKDIEIDDDMLKCCAGIVEELANSAELKADTLDGMAEAMAKFVICSTEN 895
            ||            |..|.:|.....||.|:.:.|...|.      .|:|               
pombe   753 DGHVAAHFESIFSLLKEKALEDSGFSLKLCSEVQEWSLNK------VLNG--------------- 796

  Fly   896 IEDEYKRLERIDETLTALLETPLKTTDKVQQFENHCVLLEALHG----------------SVTAG 944
                     .|:|.|.|         ||       |||:....|                .:::.
pombe   797 ---------SINEKLAA---------DK-------CVLVFNSFGKLPSNFFTFPASFWDAKISSC 836

  Fly   945 VPFENACLSRNE-----ILPLLQRSTLN--------------FSTIYKLVYQFPPPQDTNDPEDE 990
            :||.:..|..::     .|.|:....:|              .:::|.|.|.            |
pombe   837 IPFFSNKLFIDQDFILGFLDLVASEPINVDMTDVGTQFVHIFHASLYTLYYV------------E 889

  Fly   991 LTEDYCDPNADVLKKWNEPLIAELLQ---------CIRVAG----TAECWLEMSVLQSSTEELVL 1042
            .|.  ||.:|.....:...||...||         .||.||    :.||:.:..|::        
pombe   890 TTG--CDGDALFNLTFAYLLIRIYLQNGIQSIIDVPIRDAGIFVESFECYFKGEVVK-------- 944

  Fly  1043 ILSEKVQSFMGNSSDLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEE--SASILLHED 1105
                    || ...|.:.::.|.|       ...||.::....:.....::.|.  |.||...:.
pombe   945 --------FM-RDKDALTVLNELL-------IDDIDGKMPVLFKRFKNLSSAENTTSFSIFAAQG 993

  Fly  1106 LSENL-VTQGALKTYVIALQFLLPKL----SQKAITLSSAIMGTEPPEI---WVKAAVFHALLLN 1162
            |::.| |....|:.....:..:|.||    |:..|.:||.:.|.:|.|:   .::...|.|  :|
pombe   994 LTDFLIVVSNLLEMDEKHVDVVLGKLGLSSSKSPIFVSSILEGLKPLEVDSEIIQRIRFKA--VN 1056

  Fly  1163 NFEGDVNEQTDRNIIVSAVQFMTSIGERQASQKDLLH------YNVEIQRQPYESVINTVEFIKL 1221
            :..|.::   ..|.:..::..:.:...:|.::|.||.      :...|.....||.|.::|.:.:
pombe  1057 DLTGKLH---SANEVSKSLLILNAATTQQITEKPLLPITRCRLFLENITNWCSESGIKSLELLPV 1118

  Fly  1222 LTEVLKRFPY-------ELSIKNWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALI 1279
            .  ...||.|       .||...|::| .....:.:.:|...|.         ||..:||||..:
pombe  1119 C--CFLRFMYYFLPTVFSLSGSYWNSI-FDYIKYAMKMSVVDAP---------IVKSFELFALRL 1171

  Fly  1280 DFIRSEKQKSSTELLKNMIDEWDSLFAKEVNLVLFKSYYLLTHEVSVDPGFQA--CYEALLEQIT 1342
            ....|:..:.::::...:::..:|:     |.:|.|. :|.|||.::.....|  |.:.|::.:.
pombe  1172 YNALSKNYEMNSDIKDCIVESNESM-----NYLLLKR-FLFTHESTLRNSVTARMCNQYLVKLLE 1230

  Fly  1343 PVIERLDYSFVY-----SFCKSNSNITLDHLC-NFLFKQLYSVQHSVRLSAVHSLRQLTPHFVAD 1401
            ....::..||.|     |.|.|| ::.::.:| .||.::|           .|.|::||.:::.:
pombe  1231 NCPGKVVRSFQYQEFFPSLCNSN-DLQMESVCMKFLREKL-----------SHELKELTVYYMVE 1283

  Fly  1402 -----DIEL-NEKQSESL----DASTTICKWHFLNRFED----YLTRYDALITKYLEEFTF--KL 1450
                 |:.| .|..|.::    |....:.|   :.::|.    ||..:| ||..:.||.|:  ||
pombe  1284 SDYEPDVSLCPELLSLAIDFPGDPFVMVSK---MEKYEHALRVYLLVWD-LIFYHFEETTYNIKL 1344

  Fly  1451 SELDDLEPIDRHNALSYLFLWDCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRAMPVDIL 1515
            |.::.|..:|         |...::|...:   .|...|...:|.:||.:           :|  
pombe  1345 SIINQLHAMD---------LLRPLLNTLVE---ILNLSYDRPINVDKYPK-----------ID-- 1384

  Fly  1516 KNHGAKVHSNGVYKELTWSQQKDRHLPLERYACHLYTEVLRKLPAVVRRWWNATQSRQ-KNFIDN 1579
                        |..:.:|...||   :...|.|:|.:.||.|.:.||.:|:..::|. .:.:::
pombe  1385 ------------YNLMDYSSATDR---IRCLAIHIYYQCLRHLSSSVRSYWSEVKNRAFTSTVES 1434

  Fly  1580 LTTNYVSSLICSEELKAIANRKEKHE-----NMQVTVHSSTREVLAVYAIDEARMELVITLAPNY 1639
            .|...||.|:.|..|..:....|..:     ::.|.|:.:|||:..:|.:||.::|:.|.:...|
pombe  1435 FTGYNVSPLLISASLDDVERSIESEDFQSVGDVNVKVNRNTREISFIYNVDEHKLEMAIKIPSVY 1499

  Fly  1640 PLGAVKVECGKQIG-GRASSRNVGMQLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTV 1703
            ||..|:||..:::| .....|:..:.....|:.|||:|.|.|.:.|.|:...|||||||.:||:|
pombe  1500 PLQNVQVEGIERVGVNERQWRSWILASQSILSSQNGSITDALLVLKKNISMHFEGVEECAICYSV 1564

  Fly  1704 IHQETCQLPKLTCKTCKKKFHGPCLYKWFTTSSKSTCPICRNVF 1747
            :..|. .||...|.||:.|||..||||||.:|:.|.||:||:.|
pombe  1565 LSVER-TLPNKRCGTCRHKFHASCLYKWFKSSNSSRCPLCRSSF 1607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 12/20 (60%)
SPBC21D10.09cNP_596004.1 COG5219 1..1610 CDD:227544 422/1930 (22%)
RING 1557..1607 CDD:238093 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I901
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1125731
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12389
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 00.000 Not matched by this tool.
66.180

Return to query results.
Submit another query.