DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and F57C12.2

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_508118.2 Gene:F57C12.2 WormBaseID:WBGene00019014 Length:281 Species:Caenorhabditis elegans

Alignment Length:318 Identity:72/319 (23%)
Similarity:111/319 (35%) Gaps:99/319 (31%)


  Fly  1476 NACAKSPVALRAVYTNWLNDN--------KYEENFLHFLFRAMPVDILKNHGA----KVHSNGVY 1528
            |..|.|.|:  ::..|.:|.|        ||.|  .:.........|.:.|||    |:....:.
 Worm     6 NPSAISQVS--SLQNNLVNQNYTQKALIQKYNE--ANLKVENQKKSITQLHGAIQKLKMEKQNLE 66

  Fly  1529 KELT--------------WSQQKDRHLPLERYACHLYTEVLRKLPAVV----RRWWNATQSRQKN 1575
            .:|:              ||.:.:..|...:.......:.:.||...|    ....|:.|..:.|
 Worm    67 TQLSEKNSPKTPNVTENMWSLEYESKLSDAKTKIENQKKEINKLNEKVTQLKEEQQNSNQLSKNN 131

  Fly  1576 FIDNLTTNYVS-----------------SLICSEELKAIANRKEKHENMQVTVHSSTREVLAVYA 1623
            ..|....|.::                 |:..::::..|:|.  .:||.|:...:||.::|  |.
 Worm   132 ESDMRNENRLAEVRKVQENVWRQEVEKLSVTGAQQVVTISNL--SNENRQLREENSTLKLL--YN 192

  Fly  1624 IDEARMELVITLAPNYPLGAVKVECGKQIGGRASS--RNVGMQLTIFLTHQNGTIYDGLTMWKNN 1686
            .:.|:   |.|||              .|....||  .:|...|....||....:.|        
 Worm   193 ENTAQ---VNTLA--------------MISAALSSNEESVNRNLQPTPTHVENELQD-------- 232

  Fly  1687 LDKKFEGVEECYVCYTVIHQETCQLPKLTCKTCKKKFHGPCLYKWFTTSSKSTCPICR 1744
                    .||.:|     :|..:.||  |.||:||||..||.:|  |....|||.||
 Worm   233 --------TECAIC-----KEEMRFPK--CTTCRKKFHERCLQQW--TCINPTCPACR 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 9/20 (45%)
F57C12.2NP_508118.2 zf-RING_2 234..273 CDD:290367 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12389
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.