DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and Y54E10A.11

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:NP_491118.2 Gene:Y54E10A.11 WormBaseID:WBGene00021831 Length:1446 Species:Caenorhabditis elegans

Alignment Length:1961 Identity:418/1962 (21%)
Similarity:668/1962 (34%) Gaps:744/1962 (38%)


  Fly    10 RTKNNAKPSSSSRTAELLGSSTPIFVGFSAQTDGGGLVPFAPGF--ASAEQMPDSFDAAISPQTQ 72
            |.|.|||.:||:...|.|......||         ||.|....|  ||:.::....:  |..:|:
 Worm     6 RRKGNAKNASSAAAHEYLAQGGATFV---------GLTPEMNIFEVASSNRLHQVVE--IDDETR 59

  Fly    73 IILRKLSKKDPMTKKKALQELHELI--EQSDVEVLKNILPLWPKY------YLNLASDPEHTVRE 129
            |:::||:|||..|::|.|:||.|||  |.|.:|         ..|      ...|.:|...|||.
 Worm    60 IVMKKLTKKDCQTREKGLKELMELINTENSSIE---------SSYEHFCGLVAQLTTDGSPTVRM 115

  Fly   130 QTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVCMHC 194
            .|..|:...:.|.||:.:..||.::|..|.::.|.....|:.||...||.|  :|::.|:|    
 Worm   116 LTMKVISQFLTKLKKSASKGLKKIIPFVLFAKSDVTNGVAAAASAVIRDGF--DADKKRQV---- 174

  Fly   195 QVEILEYATRNLTFHTAATLSIGK---SL-----TPEDAEQKYQRVIISSLKLLSFFMGQTAQTE 251
                :|....| ||..||.::.||   ||     ..||.|.:..|:...||...           
 Worm   175 ----VELFVPN-TFDLAAKIAEGKHELSLPAEYDASEDLETRKMRLETQSLNTF----------- 223

  Fly   252 ELSQVKEGFGTLVAHQKFW-----------SFAKHKVPAIKAAWFECIYHILQSVALLDVITPQK 305
             ||.:|| :|.   ..|.|           .|.|......|.|                    .|
 Worm   224 -LSYIKE-YGN---ESKLWEEPARKLFSNSEFIKKTFAGKKEA--------------------LK 263

  Fly   306 TQLTNLCFQFIDD-----ADPVVAPHI----------------W-GCVLLLQSNYVDWFVPLNIR 348
            .||.|:.::|.|:     ::||::.:|                | |.::||...  .:....:::
 Worm   264 VQLLNISYKFSDNIEVILSNPVISTYIQASLDAQTFSTECATAWEGILILLPDE--RFHAKCSLQ 326

  Fly   349 KTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKVTQ------------------------ASLQDL 389
            |.:.|:|.:|::...| :.:.:...|||.:|.:.|                        ||:..:
 Worm   327 KGIYPRLLNLIRKKGN-HWRVLKHYLLPAVSVLLQKLENPALITSIITSFTDNLPWQAEASMNAI 390

  Fly   390 DIY-----DFYQRFF--DDMKLAVTKKFDPPLSKSDCIVIHNAYF------ECLRFLMQQINNNK 441
            ..:     ||.:...  |.:.|.:.|...|.:.:.....:|   |      ||:..|:..|...|
 Worm   391 HCWFCTFSDFVKWILGNDRINLEILKDLSPLIVEMSNQSMH---FNTAEATECISGLIHWIIEKK 452

  Fly   442 QREQKEEEFSFSLLDNNVLE---PIAWLLKSDS-----THVKIFFQHSSAL----VAF------- 487
            ..|...|  .|.||..::.|   |....|.:||     .|:::...|.:.|    |.|       
 Worm   453 VLENPAE--FFDLLKTSIYEVAPPEKSRLFADSLTLPAKHLELAHLHGNLLSNPDVDFHIIRNLA 515

  Fly   488 ----------WDRQINN--RLDNGDLYAKLLNKFWIRIFELVTQDLSAEEVNEQLLGHVLLLVQD 540
                      ..|.|||  .::|.|.:..|.....:::.|: ...||.:..|.. :|..|||.::
 Worm   516 RASNSEYFEETCRNINNFEFIENSDRFDMLQAVEIVKLIEM-KPSLSLQIKNNH-VGRQLLLSEN 578

  Fly   541 LHMANPSLES-PSVKFVEGPNEKIEKSEPTTPVKKAQEAAAFIQK-------------------- 584
            ..:...||:: |:..|.|..|...||...    |...:|..|::|                    
 Worm   579 SEIWEKSLKNVPAGVFQEMVNFWHEKRNG----KAIAQAVNFLKKMGIQLDTNAAAENVDFLISL 639

  Fly   585 -----------ELKQLVIKLVRICLDKANKGSGSGTSSSRYIEQIRTLTKMFNDAAFYKSLTDDG 638
                       |.|.||:||:....|..::..         :|...:|....|           |
 Worm   640 LQSLDSKEDPEERKNLVLKLLSALFDAEDEPK---------LEHFESLKSHLN-----------G 684

  Fly   639 DLASALNKFVSLLGQLSCQACESVVEIVFEILPLLETGKRFEYIENTLMKLPQHGVQNLLLHRLL 703
            |......|   |...:..:..|.|:||          ..||:                    :|:
 Worm   685 DFEQFFEK---LFANMEEEDAERVLEI----------AARFD--------------------KLV 716

  Fly   704 SYPLCAEAAVRQMLSGPETCEMIARIAEEVVVDNDREKLNLLHKCFFQTDTGDILINAKTVDKIL 768
            .:   .:|..|..::|    :||....|   .|...|||:.|..        |:|..::....|.
 Worm   717 GF---CDADSRGEIAG----KMILGRRE---FDEMSEKLHFLEL--------DVLTVSQHTTIIT 763

  Fly   769 LSMCGPLEQPVVDDAVEVCGSFIAQIMPVICSNNNSSLHVRQHIFLKLF-------------KFS 820
            .::..|:|.....:|.::........:..:.||.|||:|       :||             ::.
 Worm   764 DALSRPIEHLEEKEATKMVKELGRLALFSVASNYNSSIH-------QLFAWQMIRVISALGNRYC 821

  Fly   821 LEHRPEDYLSEDTLWEITTCWQDGLSSKDIEIDDDMLK------------CCAGIVEELANSAEL 873
            |:     :|.|:            |....||::..::|            |||         ...
 Worm   822 LK-----FLDEE------------LQQLRIELEKRVIKSEEIQKLINDGCCCA---------PNF 860

  Fly   874 KADTLDGMAEAMAKFVICSTENIEDEYKRLERID---ETLTALLETPLKTTDKVQQFENHCVLLE 935
            ..||. |:.|...||         :||.  |.:|   ||:....:|||:..:||           
 Worm   861 ITDTY-GIPEKRQKF---------EEYS--EDMDTKIETIYLKTDTPLEYVEKV----------- 902

  Fly   936 ALHGSVTAGVPFENACLSRNEILPLLQRSTLNFSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNA 1000
                       || |..|.|. .||               :||                      
 Worm   903 -----------FE-ASQSENS-FPL---------------FQF---------------------- 917

  Fly  1001 DVLKKW----NEPLIAELLQCIRVAGTAE---------CWLEMSVLQSSTEELVLILSEKVQSFM 1052
            |..||:    |...:...:||......||         |.: ::||.:||:    ||.:...||.
 Worm   918 DQSKKYEWLANLTFVKRFIQCGGEIFRAENLEFRDFTLCGI-ITVLDTSTD----ILIDSPHSFS 977

  Fly  1053 GNS---------SDLVAIVKERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESASILLHEDLSE 1108
            .|.         .:|..::.:..::.|..:.||                           |:.:|
 Worm   978 ENPLLEALTTLYLELFVVLTDATKRGAYSEQSV---------------------------EEWNE 1015

  Fly  1109 NLVTQGALKTYVIALQFLLPKLSQKAITLSSAIMGTEPPEIWVKAAVFHALLLNNFEGDVNEQTD 1173
                            |..|.:....|.|...|...:.|..:|:|.:....:::.|....:...|
 Worm  1016 ----------------FYTPTIHTYCIRLFRTIRRDQQPTPFVRALLRALFVISEFPTSFSNDDD 1064

  Fly  1174 RNIIVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYESVINTVEFIKLLTEVLKRFPYELSIKNW 1238
                                                   :...|||.           |||:..:
 Worm  1065 ---------------------------------------VANQEFIP-----------ELSVFKY 1079

  Fly  1239 DAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALIDFIRSEKQKSSTELLKNMIDEWDS 1303
            .|.:          ...|||            .:.|||            |:.|           
 Worm  1080 PAFQ----------ESCIAQ------------AFSLFA------------SNNE----------- 1099

  Fly  1304 LFAKEVNLVLFKSYYLLTHEVSVDPGFQACYEALLEQITPVIERLDYSFVYSFCKSNSNITLDHL 1368
                .:.|:.:....||                     .|::.:|:.:   :..|||.:..|...
 Worm  1100 ----HIQLIAYSVARLL---------------------MPIMFKLENA---AALKSNEDSELPVS 1136

  Fly  1369 CN-------FLFKQLYSVQHSVRLSAVHSLRQLTPHF--VADDIEL----NEKQSESLDASTTIC 1420
            .|       .:..:.|...|       |:     ||.  :..|:.|    |.|.|          
 Worm  1137 TNRRKLSLPVMISKSYPKDH-------HN-----PHVGPLLLDLTLLPLENTKDS---------- 1179

  Fly  1421 KWHFLNRFEDYLTRYDALITKYLEEFTFKLSELDDLEPIDRHNALSYLFLWDCIINACAKSPVAL 1485
                                .:.:|  .:::..|.::|..: |||:.|.|               
 Worm  1180 --------------------GFSQE--HRVAYCDVIDPFFK-NALNALML--------------- 1206

  Fly  1486 RAVYTNWLNDNKYEENFLHFLFRAMPVDILKNHGAKVHSNGVYKELTWSQQKDRHL-------PL 1543
                     |..:|       ||.:|:      |.::..         ||::..:|       |:
 Worm  1207 ---------DQPFE-------FRQVPI------GCRIPK---------SQERAYYLESDLSASPI 1240

  Fly  1544 --ERYACHLYTEVLRKLPAVVRRWWNATQSRQKNFIDNLTTNYVSSLICSEELKAIANRKEKHEN 1606
              :::|..|..:.:..|||.:|.::....:..........|.|.|.|:..:||..:...|.:.| 
 Worm  1241 FFDKFASRLLFKSMTLLPAAIRLFYKGMPNCFMPMFQETVTKYASRLLIEQELGKVREAKFEGE- 1304

  Fly  1607 MQVTVHSSTREVLAVYAIDEARMELVITLAPNYPLGAVKVECGKQIGGRASSRNVGMQLTIFLTH 1671
            |:|.....|.|::|.|.::|.:|:|.|.|.|:|||....:...|.|.....::...:||..:|.|
 Worm  1305 MKVRTVPVTGEIIAEYVVEETKMKLTIGLPPDYPLSVPSLTLDKAIVKTDRAKKWLLQLNAYLFH 1369

  Fly  1672 QNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIHQETCQLPKLTCKTCKKKFHGPCLYKWFTTSS 1736
            |||.|.:|:.|||.|:||..||||:|.:|...:||:|.||||:.||.||.|||..||||||.:|:
 Worm  1370 QNGAILEGIEMWKRNVDKGVEGVEDCTICMMTVHQQTHQLPKIKCKQCKNKFHSNCLYKWFESSN 1434

  Fly  1737 KSTCPICRNVF 1747
            :||||:|||.|
 Worm  1435 QSTCPLCRNNF 1445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 13/20 (65%)
Y54E10A.11NP_491118.2 zf-RING_2 1393..1442 CDD:290367 29/49 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369460144
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 240 1.000 Inparanoid score I2083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D19753at2759
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T477415
orthoMCL 1 0.900 OOG5_132362
Panther 1 1.100 LDO PTHR12389
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 1 0.960
1110.880

Return to query results.
Submit another query.