DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ltn1 and si:dkey-175g6.5

Sequence 1:NP_730427.1 Gene:Ltn1 FlyBaseID:FBgn0262517 Length:1747 Species:Drosophila melanogaster
Sequence 2:XP_001340400.3 Gene:si:dkey-175g6.5 ZFINID:ZDB-GENE-091204-127 Length:1751 Species:Danio rerio

Alignment Length:1904 Identity:508/1905 (27%)
Similarity:845/1905 (44%) Gaps:311/1905 (16%)


  Fly     1 MGGKTKQAPRTKNNAKPSSSSRTAELLGSST---PIFVGFSAQTDGG-GLVPFAPGFASAEQMPD 61
            ||||.||  |||.|.:||||.|.|:||...:   |.||||...|... |.||...|   ||::.:
Zfish     1 MGGKNKQ--RTKGNVRPSSSGRAADLLARESGVVPGFVGFGVSTSNDLGYVPAVQG---AEEIDN 60

  Fly    62 SFDAAISPQTQIILRKLSKKDPMTKKKALQELHELIEQSDVEVLKNILPLWPKYYLNLASDPEHT 126
            ..||    ..:::||||||:|.:||.||:||...:.::...:|:|.:||.||:.|..::.|.:..
Zfish    61 LVDA----DFRMVLRKLSKRDSVTKLKAVQEFGAMCQERQTDVVKGVLPYWPRIYCRISMDHDRR 121

  Fly   127 VREQTQTVLQLLMAKCKKAMAPYLKLLVPVWLGSRFDTYAPAASIASQSFRDTFAGNANRSREVC 191
            |||.||...:.|:.|.|:.:|||||.::..||.|:.|||:||||.||.:|:..|.  .|:..|..
Zfish   122 VREATQQAFEQLVLKVKRNLAPYLKSIMGHWLISQCDTYSPAASAASAAFQAAFP--LNKQTEAI 184

  Fly   192 MHCQVEILEYATRNLTFHTAATLSIGKSLTPEDAEQKYQRVIISSLKLLSFFMGQTAQTEELSQV 256
            ..|:.|||.....||...||.|||..||:..|:.|.||.|::.|||..|...:....: ::..|:
Zfish   185 SFCKDEILNVLQDNLLKETADTLSDPKSVPGEEREAKYIRLLTSSLLALKRLLCALPE-KDREQI 248

  Fly   257 KEGFGTLVAHQKFWSFAKHKVPAIKAAWFECIYHILQSVALLDVITPQ--KTQLTNLC---FQFI 316
            |:|...|:...|||.::|||.|.|:.|:||.|       |.:...|||  :.:....|   ...|
Zfish   249 KDGLSQLITQAKFWKYSKHKTPQIRGAFFELI-------ATMCERTPQLIQAEAARACSAVLLSI 306

  Fly   317 DDADPVVAPHIWGCVLLLQSNYVDWFVPLNIRKTLLPKLSSLLQNGFNRNAQAICPNLLPFLSKV 381
            ||.||:|.|.:|..||.:.|...:.::.::.:|.:||||..||:.|....|.::.||||||:||:
Zfish   307 DDTDPMVLPPLWEAVLHIMSCVDNCWMHVSAKKGVLPKLWVLLKEGARGLATSLHPNLLPFISKL 371

  Fly   382 TQASLQDLDIYDFYQRFFDDM--KLAVTKKFDPPLSKSDCIVIHNAYFECLRFLMQQINNNKQRE 444
             .|.::..|: :|.:.|...:  .|:..:....|   |:...|.::..|||||::.|   |...|
Zfish   372 -PAEVKQPDL-EFSRTFLTSIIEGLSSDRASSSP---SESAAIIDSTMECLRFIILQ---NAGDE 428

  Fly   445 QKEEEFSFSLLDNNVLEPIAWLLKSDSTHVKIFFQHSSALVAFWDRQINNRLDNGDLYAKLLNKF 509
            |::......|:...:|..|...|||.:......|...|.::..|:::...:  :...:.:||:.|
Zfish   429 QEQRNIQNMLISEQLLPLIDRALKSPALQSGPLFPQLSDMLLSWEKRAAGK--DSSTFQRLLSDF 491

  Fly   510 WIRIFELVTQDLSAEEVNEQLLGHVLLLVQDLHMANPS--------LESPSVKFVEGPNEKIEKS 566
            |..:..|.|..:..||.....|..:.||:|  .|.||:        .::..:.|.: ..|:.:..
Zfish   492 WEGLSRLCTAYVDCEESERTALEGIALLLQ--IMQNPNSVGKQTKKKKTVKISFAD-HEERGQGD 553

  Fly   567 EP--TTPVKKAQEAAAFIQKELKQLVIKLVRICLDKANKGSGSGTSSSRYIEQIRTLTKMFNDAA 629
            ||  ..||.:.|: .....:.|..||.:|..:     |....|...|.|::..:..|...|....
Zfish   554 EPPRQAPVVEEQD-CPLRHEHLLDLVCQLAEL-----NMVYVSERESERHLRFLSQLLGAFPRPE 612

  Fly   630 FY-----------------KSLTDDGDLASALNKFVSLLGQLSCQACESVVEIVFEILPLLETGK 677
            .:                 :.||::..:...|.:....|.|...:..:.:|::||..|....:..
Zfish   613 VFQVLLRPEEMKPEMGSELRPLTENAAVHFLLQRVAVWLKQEDRKDTDFLVDMVFSSLQCCSSDS 677

  Fly   678 RFEYIENTLMKLPQHGVQNLLLHRLLSYPLCAEAAVRQM-----------LSGPETCEMIARIAE 731
            ....|.|.:.|.....|...|:.:..|.|:..|..|..:           |:| :.||| .....
Zfish   678 DKTLILNQISKDLNWSVTLQLIEKACSDPVRLEVCVGWLRGSVLGERLVGLAG-DLCEM-GLCGS 740

  Fly   732 EVVVDNDREKLNLLHKCFFQTDTGDILINAKTVDKIL------------LSMCGPLEQPVVDDAV 784
            ............|:.....|....|.||....|::|:            :|..|.|| |:|....
Zfish   741 PSSSSYHAHGWPLISLALSQQHNNDPLIGKVYVEQIIDKLHATLSEAKGMSDAGNLE-PLVTFIS 804

  Fly   785 EVCGSFIAQI-------------MPV--ICSNNNSSLHVRQHIFLKL------------------ 816
            :|..:|.:.:             |.|  :|:.:.:..|:...:.|||                  
Zfish   805 DVAATFFSSVKSCLLLTSAEELLMTVFQLCAQDQTVTHLSDALLLKLRHAYIAGIESLIGFLGAG 869

  Fly   817 -FKFSLEHRPEDYLSEDTLWEITTCWQDGLSSKDIEIDDDMLKCCAGIVEELANSAELKADTLDG 880
             .|.:|.|       ...||..:......::.|.:::   :::....:.:.:|::.:...     
Zfish   870 VTKGTLLH-------NIALWVKSQLLNTPMTVKSLQV---LVQAVESLAQTIASAQKTSC----- 919

  Fly   881 MAEAMAKFVICSTENIEDEYKRLERIDETLTAL----LETPLKTTDKVQQFENHCVLLEALHGSV 941
               ..::|:.|.|.. |:|::.:.:      ||    |..||.           |..|.     |
Zfish   920 ---LFSQFICCLTPT-EEEWRHIRQ------ALPPQWLRNPLL-----------CGRLR-----V 958

  Fly   942 TAGVPFENA--CLSRNEILPLLQRSTLNFSTIYKLVYQFPPPQDTNDPEDELTEDYCDPNADVLK 1004
            |...|..:.  |.:.|.:...|..|.|    :.::::....|.| ...|.:|:|   .|:   ||
Zfish   959 TGQNPSMDVWRCRASNRLPAHLCVSAL----LGRVIFTAASPDD-QQVEADLSE---IPD---LK 1012

  Fly  1005 KWNEPLIAELLQCIRVAGTAECW---LEMSVLQSSTEELVL---ILSEKVQSFMGNSSDLVAIVK 1063
            .    :::|:...::       |   :|.|.|..|....:|   .|.:|:.:        ::::|
Zfish  1013 H----IVSEIFYGLQ-------WCEEMEFSPLTVSEYHKLLQSWSLEQKIHN--------ISLIK 1058

  Fly  1064 ERLQQAAVQQSSVIDCRLLSYLRFCPQYAAFEESA---SILLHEDLSENLVTQGALKTYVIALQF 1125
            ..|......:|                    :|:.   |:.|.:.|..|.:..|.:|....:::.
Zfish  1059 SALTDTLFTRS--------------------QENGSLWSLCLAKYLQINKMDPGDIKGLYGSVES 1103

  Fly  1126 LLPKLSQKAITLSSAI---MGTEPPEIWVKAAVFHALLLNNFEGDVNE-------------QTDR 1174
            ..| ||:.::.....:   :.:|..|..:...|...|...:.|.|.::             |.|.
Zfish  1104 FFP-LSEHSVNTLQVLCPFLASEDRESLIALCVAELLNWQDQEHDCSDGVLCCLAVLLCCLQADA 1167

  Fly  1175 NI---IVSAVQFMTSIGERQASQKDLLHYNVEIQRQPYESVINTVEFIKLLTEVLKRFPYELSIK 1236
            .:   |:.||  :::|.|.:.|:::...:|.::::.....::..||.::.|..::.|.|..|...
Zfish  1168 AVEDEILLAV--VSTIAEWRNSREEWFLFNSDLEKASAARLLLAVEMMRFLCWLVDRSPAVLGNT 1230

  Fly  1237 NWDAIRIGLSSWVLSVSKSIAQYQDPKTSLFIVAVYELFAALIDFIRSEKQKSSTELLKNMIDEW 1301
            .||.:...:.:|:.:.|::.|.:.:|...||:....||...|.:|..|.......:|...:..||
Zfish  1231 YWDLLLCSMLAWLETASENSAVFWNPWVQLFVCTNCELIVRLSEFFTSPPAGVLEQLPAELSSEW 1295

  Fly  1302 DSLFAKEVNLVLFKSYYLLTHEVSVD-----------PGFQACYEAL----LEQITPVIERLDYS 1351
            ...|.:.::.:|..    |..::.:|           |..:|..|||    :|.:|.  .:|...
Zfish  1296 KEFFQEGIHNLLLP----LLIKIPMDFPDPDDPMFPLPVLRAVGEALTYIPVELLTQ--NKLPPR 1354

  Fly  1352 FVYSFCKSNSNITLDHLCNFLFKQLYSVQHSVRLSAVHSLRQLTPHFVADDIELNEKQSESLDAS 1416
            || :..||:.:..|..|.|.|...|......::|:..|.|.::.|.....|.|....:||..|..
Zfish  1355 FV-ADQKSSLSEPLQTLLNSLSPLLLFRARPLQLAVYHILNKVMPLLPESDSESASAKSEDEDGE 1418

  Fly  1417 TTICKWHFLNRFEDYLTRYDALIT------KYLEEF--TFKLSELDDLEPIDRHNA--LSYLFLW 1471
                        |..|:...||::      :.||..  ..::.|...::|:...:.  |.||..|
Zfish  1419 ------------EPCLSPPAALMSILSTTEELLENILGAVQVGEFAVVQPLSMEHCCILGYLLSW 1471

  Fly  1472 DCIINACAKSPVALRAVYTNWLNDNKYEENFLHFLFRAMPVDILKNHGAKVHSNGVYKELTWSQQ 1536
            ..::.....|...|||.|:..|..::.....|..|||.||........:........:.|:.|..
Zfish  1472 KLLLAFFKASSSHLRAQYSLHLKKSRSLHKLLLHLFRLMPESPSMPGQSAAPKTFFTESLSLSPG 1536

  Fly  1537 KDRHLPLE--RYACHLYTEVLRKLPAVVRRWWNATQSRQKNFIDNLTTNYVSSLICSEELKAIAN 1599
            |..:|..|  ..||.:|...|:.|||:||.|||:.:.|..:.:|..|:.|||.::.::|:.::.:
Zfish  1537 KTENLQFEVSHLACSVYYGALKDLPAMVRLWWNSQEKRIFSIVDKFTSKYVSGILSAQEISSVQS 1601

  Fly  1600 RKEKHENMQVTVHSSTREVLAVYAIDEARMELVITLAPNYPLGAVKVECGKQIGGRASS-RNVGM 1663
            .....|||.|...|:||||:|.|::::..:||||.|..|||||::.|:.|:::|..... ||..:
Zfish  1602 STVTFENMTVKARSATREVIATYSVEDVFIELVIQLPQNYPLGSILVDSGRRVGVAVQQWRNWML 1666

  Fly  1664 QLTIFLTHQNGTIYDGLTMWKNNLDKKFEGVEECYVCYTVIHQETCQLPKLTCKTCKKKFHGPCL 1728
            ||:.:||||||:|.:||::||||:||:|||||:|.:|::|||.....|||..|:|||||||..||
Zfish  1667 QLSTYLTHQNGSILEGLSLWKNNVDKRFEGVEDCMICFSVIHGSNYSLPKKACRTCKKKFHSACL 1731

  Fly  1729 YKWFTTSSKSTCPICRNVF 1747
            |||||:|:|||||:||..|
Zfish  1732 YKWFTSSNKSTCPLCRETF 1750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ltn1NP_730427.1 RING <1724..1744 CDD:302633 15/20 (75%)
si:dkey-175g6.5XP_001340400.3 RING 1699..1746 CDD:302633 29/47 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369929722
eggNOG 1 0.900 E1_COG5219
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 562 1.000 Inparanoid score I1034
OMA 1 1.010
OrthoDB 1 1.010 D19753at2759
OrthoFinder 1 1.000 FOG0003544
OrthoInspector 1 1.000 T1054264
orthoMCL 1 0.900 OOG5_132362
Panther 1 1.100 LDO PTHR12389
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R672
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.