DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and LOC5667565

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_001688325.2 Gene:LOC5667565 / 5667565 VectorBaseID:AGAMI1_001760 Length:483 Species:Anopheles gambiae


Alignment Length:111 Identity:46/111 - (41%)
Similarity:62/111 - (55%) Gaps:16/111 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AILLALICLGTR-----PPPIGA----VRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLH 66
            |:..|::.:...     |.|:||    .:..:|||....||    |.|:.:   |::||.:.|..
Mosquito   334 AVFAAIVAVANAVAIGYPAPLGAYPAVAKVAAPVVAKVADD----YDPNPQ---YSYSYHIADAL 391

  Fly    67 TGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIV 112
            |||.|.|.|||.||.|.|.||::||||:.|.|.||||...||||:|
Mosquito   392 TGDNKEQQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVNGFNAVV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 28/51 (55%)
LOC5667565XP_001688325.2 None

Return to query results.
Submit another query.