powered by:
Protein Alignment Cpr76Bc and CPR98
DIOPT Version :9
Sequence 1: | NP_001097644.1 |
Gene: | Cpr76Bc / 40122 |
FlyBaseID: | FBgn0036880 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001238134.1 |
Gene: | CPR98 / 4578368 |
VectorBaseID: | AGAP010124 |
Length: | 193 |
Species: | Anopheles gambiae |
Alignment Length: | 73 |
Identity: | 42/73 - (57%) |
Similarity: | 48/73 - (65%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNA 110
|||| ..|.|||.|.|.||||||||.|:|.||.|:|.||:|:.||..|.|.||||...||||
Mosquito 105 EYAP----ANYEFSYSVHDSHTGDVKSQHETRHGDQVQGQYSLLDADGHQRIVDYTADDHNGFNA 165
Fly 111 IVKTVGAN 118
:|:...||
Mosquito 166 VVRREPAN 173
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.