DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:103 Identity:45/103 - (43%)
Similarity:56/103 - (54%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PIGAVRGGSPVVVIDE--DDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYS 87
            |..|....:||.|..:  .....||.||.:   |.|||||.|..|||.|.|.|.||||.|:|.||
  Fly    32 PAVATYAHAPVAVAQKVVVKAAEEYDPHPQ---YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYS 93

  Fly    88 VLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITES 125
            :::.||..|.|.||||...||||:|     |..|:.::
  Fly    94 LIDADGYKRIVQYTADPINGFNAVV-----NREPLVKA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 29/51 (57%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.