DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:109 Identity:47/109 - (43%)
Similarity:64/109 - (58%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITTHLPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYE-HQGYAFSYGVKDLHTG 68
            :::|.|  :.|...|.:.|....||     :.|:.|     ::..|:: |..|||.|.|.|.|||
  Fly  1116 LSSHAP--VAATAYLKSAPVTQHAV-----LKVVPE-----KHLEHFDAHPRYAFEYAVNDPHTG 1168

  Fly    69 DVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIV 112
            |.|.|.|.||||.|||.||::||||::|||.|.||.:.||:|.|
  Fly  1169 DNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 32/51 (63%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.