DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr66D

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:157 Identity:43/157 - (27%)
Similarity:70/157 - (44%) Gaps:37/157 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RPP----------PIGAVRG-GSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWE 75
            :||          |..::.| |...:.:.:.:|..||..  ::..|.|.:.|||....:.:::.|
  Fly   115 QPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEYDD--QNSSYQFGFDVKDDEFTNYQNRKE 177

  Fly    76 SRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNA---------IVK---------TVGANSHPI 122
            .|||..:||.|||::.||.||||.||||.|:||.|         :||         .:.|..|  
  Fly   178 IRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQLLRAGGH-- 240

  Fly   123 TESPEGSNQVNDDTSQSKINHYSKDQE 149
                :...:.:...|:.:..|..:.|:
  Fly   241 ----KAQQEYSSGPSKQQYQHQQQQQQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 25/51 (49%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 25/51 (49%)

Return to query results.
Submit another query.