DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:109 Identity:51/109 - (46%)
Similarity:63/109 - (57%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ITTHLPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGD 69
            ||....|::.|:.| ...|   .||..|.|:        ..|..||.:   |||:|.|:|..|||
  Fly     6 ITLICCALIAAIEC-ALLP---AAVPVGVPL--------NTEVDPHPQ---YAFAYNVQDALTGD 55

  Fly    70 VKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVK 113
            .|||.|.||||.|||.|||::.|||:|||.||||...||||:|:
  Fly    56 SKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 33/51 (65%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 33/51 (65%)

Return to query results.
Submit another query.