DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:214 Identity:49/214 - (22%)
Similarity:66/214 - (30%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FEDIFDVRHFIDSLRDEVRILRRLPKRFSRKYGYQMFEMP----PVSWSDEKYYLKQVLPL--FS 199
            ||.:..||..:|..:   .||..|.||..:|..:...|:.    .:.:.:|...|:..|.|  |.
  Fly   246 FEKLRQVRRNLDQAK---TILEALIKREEKKRDFMASEVSLQRIQLKYKNETELLEDSLALAGFP 307

  Fly   200 KHKVVHFNRTDTRLANNGLPLSLQWLRCRVNFQGLKFTPQLEALGSKLVRILQQRGPFVALHLRY 264
            ......|..::....::..|.:.|  .|    ....|||......|.|.|  .|.|         
  Fly   308 LSTAYRFGSSEDEFMDSDDPTTTQ--TC----TRPSFTPHRRFTDSNLAR--AQAG--------- 355

  Fly   265 EMDMLAFSGCTHGCTEEEAEELKKMRYTYPWWREKEIVSEERRAQGLCPLTPEE-VALVLKALGF 328
                                               .|..|.||...|..|.|.| |.|..|||..
  Fly   356 -----------------------------------SIKQEARRLGWLHKLNPNEPVMLFTKALVP 385

  Fly   329 EKNTQIYIAAGEIYGSEHR 347
            :|    ..|||.|..|:.|
  Fly   386 DK----LAAAGIIPPSDAR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.