DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr57A

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:208 Identity:46/208 - (22%)
Similarity:77/208 - (37%) Gaps:69/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YAFSY-------GVKDLHTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFNAIV 112
            |.|||       .|...||       |..||.|| :|.:|.::|...:|||.|.|| :.||:   
  Fly    32 YVFSYQAGRAPGHVDRQHT-------EVSDGSGVIRGAFSYVDPKNQVRTVQYVAD-EHGFH--- 85

  Fly   113 KTVGANSHPITESPEGSNQVNDDTS--QSKINHYSK----DQEHIVLSSDIKPLKRPIEDLTHSH 171
                         |:.|:::.|..:  .:|..|::.    .|||    ::..|.:..:.:..|:.
  Fly    86 -------------PQLSHKLEDSAAVQAAKQRHFAAYNRIAQEH----ANHTPGQVALANAPHAS 133

  Fly   172 PKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDW 236
            ..|       .||..|.:                 :.:::|||.|......|:.|......:.:.
  Fly   134 AAV-------AHATQKHL-----------------SAFERIAAEHAAIGRQQEAQRLALAAQSEH 174

  Fly   237 KAVIVNEPKEYRP 249
            ..:   |..:|.|
  Fly   175 GEI---EDGQYHP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 21/59 (36%)
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.