DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr51A

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:151 Identity:43/151 - (28%)
Similarity:66/151 - (43%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHY-EHQGYAFSYGVKD-LHTGDVK 71
            |.|.||..:|:...|      |..|....|:.:    ||..:. |:..|:|:..|.| ::.|.: 
  Fly     6 LIASLLVALCMAAPP------RQESEAERIERE----EYEKYQNENAQYSFNSSVDDKINDGQI- 59

  Fly    72 SQWESRDGDGVKGHYSVLEPDGSI-RTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDD 135
            |:.|.|:|..|:|.||..  ||.: |.|.|.|| |.|:..:...:....:..:.:|:|...|.. 
  Fly    60 SRNEEREGGTVRGSYSYF--DGFVKRRVEYIAD-KDGYRVLKDEIEDVGNGPSFNPDGIANVEG- 120

  Fly   136 TSQSKINHYS------KDQEH 150
               |.|..||      .|.:|
  Fly   121 ---SMIGKYSIKLDKADDDKH 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 21/53 (40%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 21/53 (40%)

Return to query results.
Submit another query.