DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr50Ca

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:101 Identity:39/101 - (38%)
Similarity:52/101 - (51%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPPIGAVRG--GSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGV-KG 84
            |..:.:.:|  |...|..|||....:||..||     |.|.::|.|||:.....::||..|| :|
  Fly   721 PAELDSDKGVNGLHFVNSDEDKSLQQYASKYE-----FGYRIRDFHTGNDFGHKQNRDLHGVTRG 780

  Fly    85 HYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120
            .|.:|.|||.|:.|.|.|| ..||:|.|...||..|
  Fly   781 QYHILLPDGRIQNVIYHAD-DTGFHADVSFEGATKH 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 21/52 (40%)
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 23/57 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.