DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr76Bc and Cpr30B

Sequence 1:NP_001097644.1 Gene:Cpr76Bc FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster

Alignment Length:151 Identity:48/152 (32%)
Similarity:60/152 (39%) Gaps:45/152 (30%)


  Fly    45 MEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFN 109
            ::..|.|....|.|.:.|.|.||||:|||.|||..|.|:|.|.:::.||..|.|.|.||...||.
  Fly    22 LQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQYKADDHNGFE 86

  Fly   110 AIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIK-PLKRP------IEDL 167
            |||:          ..|                            :||| ||..|      .:.|
  Fly    87 AIVQ----------REP----------------------------TDIKIPLPEPPKKLLAAKIL 113

  Fly   168 THSHPKVPSLIEIKPHARIKQ 188
            |...|..|.:....|.|.|||
  Fly   114 TPVLPVAPLVHYAAPKAIIKQ 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 26/52 (50%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.