DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr23B

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:115 Identity:42/115 - (36%)
Similarity:57/115 - (49%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPPIGAVR--GGSPVVVIDEDDETMEYAPHY------------EHQ--------GYAFSYGVKDL 65
            |.|:..:|  ..|.||...:..:..:...|.            :||        .|:|:|.|.|.
  Fly   102 PSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDA 166

  Fly    66 HTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTV 115
            .|||:|...|:|||..|:|.||:::|||..|||.||||...||||:|..|
  Fly   167 STGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 27/51 (53%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.