powered by:
Protein Alignment Cpr76Bc and CPR90
DIOPT Version :9
Sequence 1: | NP_001097644.1 |
Gene: | Cpr76Bc / 40122 |
FlyBaseID: | FBgn0036880 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_319261.3 |
Gene: | CPR90 / 1279533 |
VectorBaseID: | AGAP010107 |
Length: | 132 |
Species: | Anopheles gambiae |
Alignment Length: | 74 |
Identity: | 33/74 - (44%) |
Similarity: | 41/74 - (55%) |
Gaps: | 8/74 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 YAP-HY----EHQG---YAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTAD 103
|.| || ||.| |.::|.|.|.|||||..|.|:|..|..:|.|.:::.||..|||.|..:
Mosquito 27 YQPQHYHHEEEHHGPVHYEYNYDVHDDHTGDVHGQKEARKDDSTQGEYYLIDADGHKRTVTYHVE 91
Fly 104 AKKGFNAIV 112
.|.||.|.|
Mosquito 92 GKSGFIAEV 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.