DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and LOC1270212

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_308891.3 Gene:LOC1270212 / 1270212 VectorBaseID:AGAMI1_011125 Length:137 Species:Anopheles gambiae


Alignment Length:72 Identity:42/72 - (58%)
Similarity:48/72 - (66%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKT 114
            :|.|..|.|.|||||.||||.|||||.||||.|||.|::.|.||:.|.|.|::|...||.|.||.
Mosquito    38 YYSHPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKHNGFQAHVKR 102

  Fly   115 VGANSHP 121
            ||...||
Mosquito   103 VGHAHHP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 31/51 (61%)
LOC1270212XP_308891.3 None

Return to query results.
Submit another query.