DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18294 and CG13069

Sequence 1:NP_649115.2 Gene:CG18294 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_652418.1 Gene:CG13069 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster

Alignment Length:117 Identity:53/118 (45%)
Similarity:68/118 (58%) Gaps:27/118 (23%)


  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64
            ||| .||.:.|::||.|||||::       |||||||||..:||||.              |.:|
  Fly     1 MFKFFAVALFALIACVAAKPGIV-------APLAYSAPLVAAAPAAA--------------VYSR 44

  Fly    65 NYNGIAAAPVIAP--VAAPVVAK-YAAAP-LAAPVVAK-YAAAPLAAPVVAK 111
            .|:|..|||.:|.  ||:|.||. |.|:| :|:|.||. |.|||..||::.|
  Fly    45 EYHGNFAAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPLLLK 96

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18294NP_649115.2 None
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.