DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18294 and CG14096

Sequence 1:NP_649115.2 Gene:CG18294 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster

Alignment Length:142 Identity:109/143 (76%)
Similarity:113/143 (79%) Gaps:21/143 (15%)


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLA 130
            |||||.|||||||||||||||.|||.|                    .|:|||:.:.||||||||
  Fly    66 YNGIAVAPVIAPVAAPVVAKYTAAPFA--------------------YASPLAYSAPLAYTSPLA 110

  Fly   131 YSALP-SAPVLL 141
            |..|| :|||||
  Fly   111 YKTLPAAAPVLL 122



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139708309
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.