DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18294 and CG13679

DIOPT Version :10

Sequence 1:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_729345.1 Gene:CG13679 / 38919 FlyBaseID:FBgn0035856 Length:119 Species:Drosophila melanogaster


Alignment Length:143 Identity:65/143 - (45%)
Similarity:80/143 - (55%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAP--APVVTATSSQVIARNYN 67
            ||...|:||.|||||||:       |||| :|||||:|||.|.:|.  ||..::.|:..:|.:  
  Fly     5 AVCFFAVVAVAAAKPGLV-------APLA-AAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHS-- 59

  Fly    68 GIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLAYS 132
              ||.|          |.|.|| ..|||.|.|     .|||.|.| |||:|..:: |||||||||
  Fly    60 --AAFP----------AAYTAA-YTAPVAAAY-----TAPVAAAY-AAPIAPYAA-AYTSPLAYS 104

  Fly   133 ----ALPSAPVLL 141
                |..:||:||
  Fly   105 SPYVATAAAPLLL 117

Return to query results.
Submit another query.