DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18294 and CG32213

Sequence 1:NP_649115.2 Gene:CG18294 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_730413.2 Gene:CG32213 FlyBaseID:FBgn0052213 Length:129 Species:Drosophila melanogaster

Alignment Length:145 Identity:109/146 (75%)
Similarity:118/146 (81%) Gaps:20/146 (14%)


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.|||:||:||||||||||||||||||      ||||||||||||||||||||||||||||||
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYT------APLAYSAPAAVVAAPAPVVTATSSQVIARN 59

  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAP----LAHISSLAYT 126
            |||||:|||||||         ||||||||||||||.||||||||||||.|    ||:.|.|||:
  Fly    60 YNGIASAPVIAPV---------AAPLAAPVVAKYAATPLAAPVVAKYAATPLAARLAYSSPLAYS 115

  Fly   127 SPLAYSALPSAPVLL 141
            :||:|:|.| ||.|:
  Fly   116 APLSYAAAP-APFLI 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139708316
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.