DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and CG14095

DIOPT Version :8

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster

Alignment Length:129 Identity:72/130 (55%)
Similarity:84/130 (65%) Gaps:24/130 (18%)


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.||||.|::||.|||||||..|||             :.||.|:|||||||||.||||:||.
  Fly     1 MFKYAVVICALIACVAAKPGLLHTPLA-------------ALPAPVIAAPAPVVTAASSQVVART 52

  Fly    66 YNGIAVAPVIA--PVA-APV---VAKYTAAPFA--YASPLAYSAPLAYTSPLAYKTLPAAAPVL 121
            :||||.|||||  ||| |||   ||...|||.|  .|:||...||:|:.:|:|   .|.|||:|
  Fly    53 FNGIAAAPVIAQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVA---APLAAPIL 113



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139708410
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.