DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and CG13678

DIOPT Version :8

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648193.1 Gene:CG13678 / 38922 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster

Alignment Length:131 Identity:64/132 (48%)
Similarity:77/132 (58%) Gaps:14/132 (11%)


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATS---SQVI 62
            |||.|.:..|:||.||||||:| |||| .|||||:|| |....||.||..|...||.|   |...
  Fly     1 MFKFAAIFFAVVAVAAAKPGIL-APLA-AAPLAYTAP-AVVGSAAYVAPYASSYTAHSVAHSAAF 62

  Fly    63 ARNYNGIAVAPVIAPVAAPVVAKYTAAPFAYASP--LAYSAPLAYTSPLAYKTLP----AAAPVL 121
            ..:|.....|...||:|||:.|.|||....:|:|  .||::||||:||  |...|    ||||:|
  Fly    63 PASYAAPVAAAYTAPIAAPLAAAYTAPYTRFATPYAAAYTSPLAYSSP--YVARPYVAAAAAPLL 125

  Fly   122 L 122
            |
  Fly   126 L 126



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.