DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14096 and 825-Oak

DIOPT Version :8

Sequence 1:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_730410.2 Gene:825-Oak / 317916 FlyBaseID:FBgn0052208 Length:129 Species:Drosophila melanogaster

Alignment Length:137 Identity:95/138 (69%)
Similarity:103/138 (75%) Gaps:23/138 (17%)


  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65
            |||.|||:||:||||||||||||||||||      ||||||||||||||||||||||||||||||
  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYT------APLAYSAPAAVVAAPAPVVTATSSQVIARN 59

  Fly    66 YNGIAVAPVIAPV----AAPVVAKYTAAPFA-----------YASPLAYSAPLAYTSPLAYKTLP 115
            |||||.|||||||    ||||||||.|.|.|           .|:.||||:||||::||:|...|
  Fly    60 YNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAATPLAARLAYSSPLAYSAPLSYAAAP 124

  Fly   116 AAAPVLL 122
              ||.|:
  Fly   125 --APFLI 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139708355
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.