DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chd3 and kis

Sequence 1:NP_649111.1 Gene:Chd3 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster
Sequence 2:NP_001137761.1 Gene:kis FlyBaseID:FBgn0266557 Length:5517 Species:Drosophila melanogaster

Alignment Length:925 Identity:321/926 (35%)
Similarity:498/926 (54%) Gaps:121/926 (13%)


  Fly    17 ASKDKRPKTNAKK----QKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICP 77
            |...|.|:|..:|    :|..|::.....::|.|....|.          |.|.::..:.:   .
  Fly  1786 ADHAKEPETVLEKMEVDEKANDDQSAVSKAEGSDEKSTDD----------SNPEEATTEKN---K 1837

  Fly    78 RCIPLPGKAEKILSWRWALDRSVELRTSKGEKRR---------EYFIKWHGMSYWHCEWIPEGQM 133
            ..:.:.|:.|::.....::.:..:.:|....:.:         |||:|:...||.||||..|.::
  Fly  1838 ESLEIEGEKERVKEGEESVKKENDEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTEEEL 1902

  Fly   134 L---LHHASMVASFQRRSDMEEPSLEELDDQDGNLHERFYRYGIKPEWLLVQRVIN---HSEEPN 192
            |   ...|:.:..||::...:....|.::|:..|           .::..|.||::   |::|.:
  Fly  1903 LKGDRRVAAKIRRFQQKQSQQLNIFENIEDEPFN-----------QDFTEVDRVLDMSVHTDETS 1956

  Fly   193 GGTM--YLVKWRELSYNDSSWERESDSIPGLNQAIALYKKLRSSNKGRQRDRPAPTIDLNKKYED 255
            |.|.  |||||:.|.|.|.:||.|.|......:....:.|:...::.:.:.||.|  :|.||.|.
  Fly  1957 GETTKHYLVKWKSLPYEDCTWELEEDVDNDKIEQYLRFNKIPQRSEWKSKKRPHP--ELWKKLEK 2019

  Fly   256 QPVFLKEAGLKLHPFQIEGVSWLRYSWGQGIPTILADEMGLGKTIQTVVFLYSLFKEGHCRGPFL 320
            .||:  :.|..|.|:|:||::||::||......|||||||||||||::.|::|:::.| .|||||
  Fly  2020 TPVY--KGGNSLRPYQLEGLNWLKFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYG-IRGPFL 2081

  Fly   321 ISVPLSTLTNWERELELWAPELYCVTYVGGKTARAVIRKHEISFEEVTTKTMRENQTQYKFNVML 385
            :..||||:.||:||.|.|. ::..|.|.|..|::.:|:.:|..::..:.|.::|   ..||||::
  Fly  2082 VIAPLSTIPNWQREFEGWT-DMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKE---PIKFNVLI 2142

  Fly   386 TSYEFISVDAAFLGCIDWAALVVDEAHRLRSNQSKFFRILSKYRIGYKLLLTGTPLQNNLEELFH 450
            |::|.|..|...|...:|...|:||||||::...|....|.:..:.:::||:|||||||:.|||.
  Fly  2143 TTFEMIVTDYMDLKAFNWRLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFS 2207

  Fly   451 LLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLKADVLKSMPPKSEFIVRVELS 515
            |||||...:|:..:.|.:||..:..||:|.:|..:|:|.||||||.||.||:.||.|.|:.|||:
  Fly  2208 LLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELT 2272

  Fly   516 SMQKKFYKHILTKNFKALNQKG--GGRVCSLLNIMMDLRKCCNHPYLFPSAAEEATI-------- 570
            ::|||:|:.||.:||..| :||  ...:.:|:|.||:|||||.||||...|.|:...        
  Fly  2273 NIQKKYYRGILEQNFSFL-KKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQHGE 2336

  Fly   571 SPSGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNVLEHFLEGEGYQYDRIDGS 635
            .|...|:  :|..::||:.|:.|:|.:|||:.||||:||||.:.|::||.:|....|.::||||.
  Fly  2337 DPESYYK--NLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGR 2399

  Fly   636 IKGDLRQKAIDRFNDPVSEHFVFLLSTRAGGLGINLATADTVIIFDSDWNPHNDVQAFSRAHRMG 700
            |:|:|||:||||::.|.|:.|||||.|:||||||||..||||||:||||||.||:||.:|.||:|
  Fly  2400 IRGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARCHRIG 2464

  Fly   701 QKKKVMIYRFVTHNSVEERIMQVAKHKMMLTHLVVRPGMGGMTTNFSKD---------ELEDILR 756
            |:|.|.|||.:..|:.|..:...|..|:.|...|::    .|.|..|||         |:||:|:
  Fly  2465 QRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQ----SMNTQGSKDGNNKQLSKKEIEDLLK 2525

  Fly   757 FGTEDLFKDGKSEAIHYDDKAVADLLDRTNRGIEEKESWANEYLSSFKVASYATKEDHEEHDDYN 821
            .|......|..:....:.::.:..:|.|..:.|    :..:|..|:|..||:|...:       .
  Fly  2526 KGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVI----TMESEKGSTFSKASFAASGN-------R 2579

  Fly   822 NDAENTDPFYWENLMGK------------------SQPKLPKKQKK------------QSQQSQV 856
            :|....||.:|.....|                  |:|:...:.|:            :|.....
  Fly  2580 SDITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRYGHEDVMELNSEESSNENS 2644

  Fly   857 DVESIMGKGKRIRKE 871
            |.|..:|...|.|||
  Fly  2645 DEEGGIGLRSRRRKE 2659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007 5/42 (12%)
CHROMO 85..147 CDD:237991 17/74 (23%)
CHROMO 181..233 CDD:214605 20/57 (35%)
SNF2_N 270..561 CDD:278600 133/293 (45%)
DEXDc 288..440 CDD:238005 62/152 (41%)
Helicase_C 585..700 CDD:278689 69/115 (60%)
kisNP_001137761.1 BASP1 1554..1786 CDD:283191 321/926 (35%)
HepA 1676..2527 CDD:223627 294/781 (38%)
SDA1 <1693..>1854 CDD:283052 14/81 (17%)
CHROMO <1879..1919 CDD:237991 15/40 (38%)
Chromo 1941..1996 CDD:278797 19/55 (35%)
DEXDc 2048..2197 CDD:238005 62/154 (40%)
Helicase_C 2350..2464 CDD:278689 69/114 (61%)
RR_TM4-6 3728..>3877 CDD:283990
BRK 4569..4613 CDD:197800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C138564599
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D54215at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45623
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.