DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14086 and TMEM72

Sequence 1:NP_649102.3 Gene:CG14086 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001116848.1 Gene:TMEM72 HGNCID:31658 Length:275 Species:Homo sapiens

Alignment Length:173 Identity:41/174 (24%)
Similarity:69/174 (40%) Gaps:23/174 (13%)


  Fly    34 RVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQL--QCAEDNYQ-- 92
            |:.|:.|:.|:.|||.:.::.|....|  |::|:...|...|..:.|...|.:  ||...:..  
Human    15 RLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADR 79

  Fly    93 -RRSCSCLACWRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILLGL--LRLCTLLR 154
             |.....|.|::...         .|.::.:...|:|..:|...:.|..||:.||  ..|....:
Human    80 VREKAHWLGCFQKFL---------AYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKK 135

  Fly   155 FSASKEEGLLPQCDFEKVSSFVDT-----MEDDFAEIGATQAG 192
            ..|:.|....|:...:..||.|.|     .|..:...||.:.|
Human   136 RKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEG 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 24/111 (22%)
TMEM72NP_001116848.1 TMEM72 4..189 CDD:318306 41/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1128211at2759
OrthoFinder 1 1.000 FOG0007380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28474
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.