DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14086 and tmem72

Sequence 1:NP_649102.3 Gene:CG14086 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001315015.1 Gene:tmem72 ZFINID:ZDB-GENE-090313-175 Length:298 Species:Danio rerio

Alignment Length:147 Identity:34/148 (23%)
Similarity:64/148 (43%) Gaps:35/148 (24%)


  Fly    26 CECLRPVIRVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQLQCAE 88
            |.|     ||.|:.|:.|:|.||::....|....|  |::.|::::|..|:.:.:...|      
Zfish    12 CSC-----RVLGISTAAVLCAVGIETQSQGEFTSLAVYLLLSSLVIMIFEVAYFIDALL------ 65

  Fly    89 DNYQRRSCSCLAC---------WRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILL 144
                   .:||.|         |:..|..||::....|.::.:...|:|..:|.:.:.|:.|::.
Zfish    66 -------ATCLPCPPTWKMFILWKKMAKVGGFQKFLYYTMMSVMCFLHPVLVWHAVIPGIMLVVT 123

  Fly   145 GLLRLCTLLRFSASKEE 161
            |      ...|..||::
Zfish   124 G------FFNFILSKKK 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 26/120 (22%)
tmem72NP_001315015.1 TMEM72 2..144 CDD:292672 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1128211at2759
OrthoFinder 1 1.000 FOG0007380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28474
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.