DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14086 and Tmem72

Sequence 1:NP_649102.3 Gene:CG14086 FlyBaseID:FBgn0036860 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001102113.1 Gene:Tmem72 RGDID:1308850 Length:275 Species:Rattus norvegicus

Alignment Length:179 Identity:41/180 (23%)
Similarity:73/180 (41%) Gaps:26/180 (14%)


  Fly    34 RVFGLLTSFVICGVGVDVYMHGYRAGL--YIVFSAVLVMFIEIKWLVTIFLQL--QCAEDNYQRR 94
            |:.|:.|:.|:.|||.:.::.|....|  |::|:.|.:...|..:.|...|.:  :|...:...|
  Rat    15 RLLGITTAAVLIGVGTETFLRGRFKSLAFYLLFTGVTISVCEGTYFVAQLLAICFKCQPGSLAHR 79

  Fly    95 SCSCLACWRLSAICGGWRPTPVYAVIGICLILYPHNLWLSYVAGMFLILLGLLRLCTLLRFSASK 159
            :.. .|.|     .|.::....|.::.:...|:|..:|...:.|..||:.||    .....|..|
  Rat    80 AKE-KAHW-----LGCFQKFLAYMLLSVACFLHPVLVWHVTIPGSMLIITGL----AYFLLSKRK 134

  Fly   160 EEGLLPQCDFEKVSSFVDTMEDDFAEIGATQAGLD-------EEAEEEG 201
            ::...|:     |....:...|..:.|.:|....|       .||.:||
  Rat   135 KKKAAPE-----VMPPTEQYRDPSSSIVSTTGSGDTEQTYTFHEAFKEG 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14086NP_649102.3 TMEM72 29..>138 CDD:292672 24/108 (22%)
Tmem72NP_001102113.1 TMEM72 2..189 CDD:292672 41/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1128211at2759
OrthoFinder 1 1.000 FOG0007380
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR28474
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.